KEGG   Truepera radiovictrix: Trad_1389Help
Entry
Trad_1389         CDS       T01254                                 

Definition
(GenBank) homoaconitate hydratase family protein
  KO
K16792  methanogen homoaconitase large subunit [EC:4.2.1.114]
Organism
tra  Truepera radiovictrix
Pathway
tra00300  Lysine biosynthesis
tra00680  Methane metabolism
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01210  2-Oxocarboxylic acid metabolism
tra01230  Biosynthesis of amino acids
Module
tra_M00433  Lysine biosynthesis, 2-oxoglutarate => 2-oxoadipate
Brite
KEGG Orthology (KO) [BR:tra00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Trad_1389
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Trad_1389
Enzymes [BR:tra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     Trad_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase YukD
Motif
Other DBs
NCBI-ProteinID: ADI14511
UniProt: D7CX03
Position
1490451..1491722
Genome map
AA seq 423 aa AA seqDB search
MRPPDLAGLTLAERILSVRAGRRVRAGDLVVVDVDQVMVVDSIAPSVIRRIEGDLGGRVR
NPERVSFVLDHVAPAANVEVAKAQADARRYARERGFRLFDVGRGICHQVLMEEGLAQPGG
VVLGSDSHATTYGAVGCFGTGMGATDIALAAASGKTWLKVPETVAVKLTGTLPAGVSAKD
VALSVIRELTADGATYASLELHTPDGFTLSERMTLANLAVEAGAKVGLVPPSGEVRERFS
VPEWLVVDSRARYARVVELDLGALEPVVAAPPFVDNVHPLTAFTGVHVDQVFVGTCTNGR
LDDLHVVADILRGKRVAEGTRLLVIPASSQVLEAAAADGTLSTLLAAGAVLGTPGCGPCM
GRHMGVLAPGEVCVSTSNRNFVGRMGSPEAQIFLASPAVAARAALSGTLTLAEDAALPER
AVA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgaggccacccgacttagcggggctgacgctcgccgagcgcatcctctcggtgcgcgcg
gggcgccgcgtccgggctggcgacctcgtcgtggtcgacgtcgaccaggtgatggtggtc
gactcgatcgccccgtcggtgatccggcgcatcgaaggggacctcggcgggcgcgtccgc
aaccccgagcgcgtctcgttcgtcctcgaccacgtcgcgccggcggccaacgtggaggtc
gcgaaagcgcaggcggacgcgcgccgctacgcccgtgagcgcggcttccggctcttcgac
gtggggcgcggcatctgccaccaggtgttgatggaggagggcctcgcccaacccggcggc
gtcgtgttgggttcggactcgcacgcgaccacctacggcgcggtcggctgcttcggtacc
ggcatgggcgcgaccgacatcgcgctcgcggcggcgagcggcaagacctggcttaaagtg
ccggaaacggtcgctgtaaagctcacggggacgctacccgcgggggtgagcgccaaagac
gtggccctgagcgttatccgcgagctcaccgccgacggcgccacctacgccagcctcgag
ctccacacccccgacggcttcaccctctccgagcgcatgacgctcgccaacttggccgtc
gaggcgggggcgaaggtcggtctggtgccgccgagcggggaggttcgggagcgcttctcg
gtgcccgagtggctcgtggtcgactcccgagcgcgctacgcccgcgtcgtggagctcgac
ctcggcgccctggagccggttgtcgccgcgccaccttttgtcgacaacgtccacccgctc
accgcattcaccggcgtgcacgtcgaccaggtgtttgtcgggacctgcaccaacggccgt
ctggacgacctgcacgtcgtcgccgacattctgcgcggcaagcgcgtggccgaggggacg
cggcttttggttatcccggcgagctcgcaggtgttggaggcggctgccgccgacgggacg
ctctcgacgctgctcgcggcgggcgcggtcctggggacccccggttgcggcccctgcatg
gggcggcacatgggcgtcttggcccccggcgaggtgtgcgtgtcgacgagcaaccgcaac
ttcgtcggccgtatggggagccccgaagcgcagatctttctggcgtccccggcggtggcg
gcgcgcgcggcgctctcgggcaccctcaccctcgccgaggacgccgcgcttcccgaacgg
gcggtggcgtga

DBGET integrated database retrieval system