KEGG   Truepera radiovictrix: Trad_2188Help
Entry
Trad_2188         CDS       T01254                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tra  Truepera radiovictrix
Pathway
tra00010  Glycolysis / Gluconeogenesis
tra00020  Citrate cycle (TCA cycle)
tra00620  Pyruvate metabolism
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01130  Biosynthesis of antibiotics
tra01200  Carbon metabolism
Module
tra_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trad_2188
   00020 Citrate cycle (TCA cycle)
    Trad_2188
   00620 Pyruvate metabolism
    Trad_2188
Enzymes [BR:tra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Trad_2188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ADI15300
UniProt: D7CRX2
Position
2369544..2370977
Genome map
AA seq 477 aa AA seqDB search
MATEFKLPEVGEGITSGTVVGVLVSVGDTIAKDQAVLELETDKAVVEVPSSVSGVVQEIL
VKENEEASVGQVVLIVGEGESEGAGAEKGAADAQAQDTQTQETQAPSEEGRPSAGAADAA
AEEDVAQEVAEERAEGDAEAKAAGIDAAAKAADAEGAQRAPDAYDTPLEEKEPLPAAPSV
RRLARELGVNLRDVKGSGILGRISAEDVRRVAAGGAQPSAQPASPPAAPAPAAQPLPDFS
KYGSVRREPMSGIRKATVRSMTNAWSSVPMVTHFDKADTAAFEAFRQRYKARAEAAGAKL
TPTAVLLKMAALALKKFPKFNASLDLATNEVVYKDYLNVGVAVDTEYGLLVPVIRDVDKK
GVVQLAKELGEIAEKARARKLGPEDMQGGNFSISNLGGIGGTGFTPIVNPPEVAILGVAR
GTVEPVWDAEAGEFKPRTMMPLSLSYDHRLIDGADAARFLRFLCETIEDPYLMAVEG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaattcaaactgcctgaagtaggggaaggaatcacctcgggaaccgtcgtc
ggggtgctcgtctcggtcggtgacaccatcgccaaagaccaagcggtgctagagctcgag
accgacaaagcggtcgtcgaggtgccgtcgtcggtctcgggggtggttcaggagattttg
gttaaagagaacgaagaggcctcggtcggtcaggtcgtgctgatcgtcggcgagggtgag
agcgagggcgcaggggccgaaaagggcgctgccgacgcccaagcgcaagacacccaaacg
caggaaacccaggccccgagcgaggagggccgcccctcggcgggcgccgccgacgcggcg
gccgaagaggacgtcgcgcaggaggtcgccgaagagcgcgccgagggggacgccgaggcc
aaagccgcggggatcgacgctgctgccaaagccgcggacgccgaaggggcgcagcgggcc
cccgacgcctacgacacccccctcgaggagaaagaacccctccccgccgccccgtcggta
cgccgcctagctagggagctcggcgtcaacctgcgcgacgtcaagggttctggcatcttg
gggcgcatctccgccgaggacgtgcggcgcgtcgccgccgggggggcgcaaccgagcgca
caacccgcctcaccacccgccgcaccggcgcccgccgcgcagccgctacccgactttagc
aagtacggctccgtacgccgcgagccgatgtcggggattcgcaaggcgacggtgcgctcg
atgaccaacgcgtggtcgagcgtaccgatggtcacgcacttcgacaaggccgacacggcc
gcctttgaggcgtttcgccaacgctacaaggcccgcgccgaggccgccggcgccaagctc
accccgaccgccgtcctgctcaagatggccgcgttagcgctcaagaagtttccgaagttc
aacgcctccttggacctcgcaacgaacgaggtcgtctacaaggactacctcaacgtcggc
gtcgcggtcgacaccgaatatggcctcctggtgcccgtcattcgcgacgtggacaaaaag
ggcgtggttcagctcgccaaagagctgggcgagatcgccgaaaaagcgcgcgcccgcaag
ctcggccccgaggacatgcaggggggcaacttcagcatctcgaacctgggcggcatcggt
gggacgggctttacacccatcgtcaacccgccggaggtcgccatcttgggcgtcgcccgg
ggcacggtcgaacccgtttgggacgctgaggctggcgagttcaaaccgcgcaccatgatg
cccctgtcgctttcgtacgatcaccggctcatcgacggcgccgacgccgctagattcttg
cgcttcctctgcgagaccatcgaggacccctacctgatggcggttgagggctaa

DBGET integrated database retrieval system