KEGG   Truepera radiovictrix: Trad_2330Help
Entry
Trad_2330         CDS       T01254                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tra  Truepera radiovictrix
Pathway
tra00260  Glycine, serine and threonine metabolism
tra00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01130  Biosynthesis of antibiotics
tra01230  Biosynthesis of amino acids
Module
tra_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Trad_2330
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Trad_2330
Enzymes [BR:tra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Trad_2330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADI15440
UniProt: D7CSM0
Position
2537754..2538557
Genome map
AA seq 267 aa AA seqDB search
MSRIERAFERARAEGRAAFIPFLTAGFPDERRFLAEARALLEVADVLEVGLPYSDPLGDG
PTIQRASERALAQGMTTRKTFELVAELRAQSDKAIVLMTYYNPIYCYSHGARGEAGFVAD
LKAAGADGVILPDLPPDEADTLLPAARAAALDTIFLVAPTSTDARLKLVTAACRGFVYAV
SVTGVTGARAALPEDVPNLVRRTKAVSDLPVAVGFGVAHAQSARAVAAVADGVVVGSALI
GALERGEALAPLARELAAACSKEVTAP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaattgagcgcgcgttcgagcgcgcgagagccgaaggccgcgcggcctttatc
cccttcctaacggctggttttcccgacgaacggcgttttctggcggaggcgcgcgcgctt
ttagaggtcgccgacgtgctcgaggtcggtctcccctactccgaccccttgggcgacggc
ccgaccatccagcgcgcctcggagcgcgccctcgcgcaggggatgaccacgcgcaaaacg
tttgagctcgtcgccgagctgcgcgcgcagagcgacaaggccatcgtgctgatgacctac
tacaaccccatctactgctacagccacggggcgcggggcgaagcgggtttcgtggccgac
ctcaaggccgcgggcgccgacggcgtgatcctccccgacctcccccccgatgaggccgac
acgctcctgcccgcagcgcgcgccgcggcgctcgacaccatcttcctggtcgccccgacc
tccacggacgcgcggctaaaacttgtcaccgcagcgtgccgcgggtttgtctacgcggtc
tcggtcacgggggtgacgggggcgcgcgcggcgctccccgaggacgtccccaacctcgtg
cggcgcaccaaggcggtgagcgacctgccggtggcggtcggcttcggggtagcacacgcc
cagagcgctcgagccgtcgcggcggtcgccgacggcgtggtggtcggctcggcgctgatc
ggcgccttggagcgcggcgaggcgttggcgccgctcgcgcgcgagctcgcggcagcgtgc
agcaaagaggtcacggcgccttag

DBGET integrated database retrieval system