KEGG   Truepera radiovictrix: Trad_2941Help
Entry
Trad_2941         CDS       T01254                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
tra  Truepera radiovictrix
Pathway
tra00010  Glycolysis / Gluconeogenesis
tra00520  Amino sugar and nucleotide sugar metabolism
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01130  Biosynthesis of antibiotics
tra01200  Carbon metabolism
Module
tra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trad_2941
   00520 Amino sugar and nucleotide sugar metabolism
    Trad_2941
Enzymes [BR:tra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Trad_2941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADI16035
UniProt: D7CW85
Position
3203526..3204287
Genome map
AA seq 253 aa AA seqDB search
MGAVKHVLGIDIGGSGIKGALVDIEAGGLATERYRLETPQPATPEAVAETVGKIVAHFAY
SGPIGCTFPAIVRHGVTLSAANVDKSWIGTDADALFSRVTGLEVHLLNDADAAGEAEMRF
GAGRGRSGTVIMLTFGTGIGSAVFLDGKLLPNTEFGHLYLEGGQEAEAWASDRARKLADL
SWKKWAARVQTYLKHLEFLFSPDLFIVGGGVSKKSDKFLPLLELGTEVVAAELRNEAGIV
GAALAVARGAREG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgtgaagcacgttttaggtatcgacatcggcggttcggggattaaaggtgcg
ctcgtcgacatcgaagcgggggggctcgcgaccgagcgctaccgcctcgagaccccccag
cccgcgacgccggaagccgtcgccgagacggtcgggaagatcgtcgcgcactttgcctac
agcgggcccatcggctgcaccttccccgccatcgtccggcacggggtgacgctctcggcg
gccaacgtcgacaagagctggatcggcacggacgccgacgcgctcttttcccgcgtcacg
gggctcgaggtccacctgctgaatgacgcggacgccgcgggcgaagccgagatgcgtttc
ggggcgggcagggggagaagcggcacggtcatcatgctcaccttcggcacgggcatcggg
agcgcggtgtttctagacggtaagctgctgcccaacaccgagttcgggcacctctacctc
gagggggggcaggaggccgaagcgtgggcgtcggaccgcgcgcgcaaactggcggacctc
agctggaaaaagtgggccgcccgggtacagacctaccttaagcacctcgagttcctcttc
tcccccgacctctttatcgtcggcggcggcgtcagcaaaaagagcgacaagttcctcccc
ttgctcgagctcggcaccgaggtcgtagcggcggagctgcgcaacgaagcgggaattgtg
ggcgcggccctagcggtcgctcgcggggctcgtgaagggtga

DBGET integrated database retrieval system