KEGG   Thermocrinis ruber: THERU_02340Help
Entry
THERU_02340       CDS       T03001                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
trd  Thermocrinis ruber
Pathway
trd00860  Porphyrin and chlorophyll metabolism
trd01100  Metabolic pathways
trd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:trd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THERU_02340
Enzymes [BR:trd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     THERU_02340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C ATPase
Motif
Other DBs
NCBI-ProteinID: AHE95703
UniProt: W0DFB0
Position
425276..426646
Genome map
AA seq 456 aa AA seqDB search
MKTIFNKSLIEKYDKPGPRYTSYPPATEFTESVGKEDYKKKLLESNQGKRPLSLYIHIPF
CESACWFCGCNVIISHRKDVSKRYLDYLYREMELLGKYLDKSRKVVQIHWGGGTPNFLTV
EEMEELFSKIKENFSVDEDAEISVEIDPRYLSEGQLETLRQLGFNRVSMGLQDLDEEVQR
AINRIQPESLMRDVMKQLRDLGFKSINIDLVYGLPYQTPEKFRRTIEKTIELDPDRVAVY
NFAYVPWLKPLQRRIDPSTLPPPEDKLTILEMTIEMFQSAGYLYIGMDHFAKPEDELAIA
QREGSLWRNFQGYTTKKGVDLIGIGATSIGMFYDAYFQNYKTLREYYLALDSGDFATMRG
FLLGQEDLLRREVIMDLMCNFRCDFDRIERAFGINFEEHFEEELEKLKDMERDGLVEIKD
RSIRVLPMGRLLVRNVAMTFDQYLPKKKEMRFSRTI
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatttttaacaaaagtcttatagagaagtacgacaaaccgggtcccaggtac
accagctaccctcccgccacggagttcaccgaaagcgtaggaaaggaagactacaagaaa
aaactattagagagtaatcagggcaaaagacctctttctttgtatattcacattcccttc
tgtgagagcgcttgctggttctgtgggtgcaatgtgatcatatcccacagaaaggatgtg
agcaaaagatacttggactacctttacagagagatggaacttttaggtaaatacttagac
aagtcaaggaaggtggtgcagatccactggggcggtggaactcccaacttccttactgtg
gaggaaatggaagagcttttctcaaagataaaggaaaacttttctgtggatgaggatgcg
gaaataagcgtagagatagacccaagatatctgtctgaggggcagttggaaaccctaaga
cagcttgggtttaacagggtcagcatgggtctgcaggatttagatgaggaggtccagagg
gcgataaaccgtatccaaccagaatccctaatgagggatgttatgaaacaactgagggac
ctgggctttaaaagcataaacatagacctagtatatggacttccctatcaaacaccagag
aagttcagaagaaccatagaaaaaaccatagagcttgatccagaccgggttgcggtttat
aactttgcctatgtaccctggctaaagccccttcaaagaagaatagacccaagtacactt
cctccgccggaggacaaactgacgatccttgagatgaccattgaaatgtttcaatcagcg
ggctatctttacattggcatggaccactttgccaagccagaggacgaactggcaatagcc
cagagggaaggaagtctttggaggaactttcagggttacactaccaaaaagggcgtggat
cttataggcataggtgccacatccattgggatgttctacgatgcgtactttcaaaattac
aagaccctgagggagtattatttggctttggatagtggagactttgccaccatgaggggc
ttcttgctggggcaggaggaccttctcagaagagaggtaattatggatttgatgtgcaac
tttaggtgtgattttgaccgtatagagagggcttttggcataaactttgaagagcacttt
gaggaggagcttgagaaactcaaagatatggaaagggatggactggtagaaatcaaggac
aggtctataagggttttgcctatgggcaggcttcttgttagaaacgtggctatgaccttt
gaccagtatttaccaaagaaaaaggaaatgcgcttttcaagaaccatatga

DBGET integrated database retrieval system