KEGG   Trichoderma reesei QM6a: TRIREDRAFT_22464Help
Entry
TRIREDRAFT_22464  CDS       T02991                                 

Definition
(RefSeq) hypothetical protein
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
tre  Trichoderma reesei QM6a
Pathway
tre00071  Fatty acid degradation
tre00380  Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TRIREDRAFT_22464
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    TRIREDRAFT_22464
Enzymes [BR:tre01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     TRIREDRAFT_22464
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     TRIREDRAFT_22464
Cytochrome P450 [BR:tre00199]
 Cytochrome P450, bacteria type
  CYP102 family
   TRIREDRAFT_22464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1 Flavodoxin_5
Motif
Other DBs
NCBI-GeneID: 18484130
NCBI-ProteinID: XP_006965911
JGI: Trire2_22464
UniProt: G0RLA6
Position
Unknown
AA seq 1065 aa AA seqDB search
MAETVPIPEPPGLPLLGNLGEFSQNPIADIIRLADTYGEIYRLHLGTRPAVFVSTQALVN
ECCDEKRFQKSLSSVLRIVREGVHDGLFTAHSDEPNWGKAHRILTPAFGPLPIRDMFDEM
HDISSQLALKMARHGPHEPIAVSDEFTKLALDTIALCSMNYRFNSYYQEKMHPFVQAMSD
FLAECSRRNRRPGFAPNFLYRAANEKFFNDIAIMRDTANAVVEARKKNPSDRKDLLGAML
NAVDPLTGEKLSDANITDQLITFLIAGHETTSGMMSFAFYHLLKNPDAYRKVQEEVDSVL
GRGPAKVDHVSKLTYIQAVLRETLRVTAAIPAFSVEALEDTIIGGKYLVHKGEPISLVLA
KSHLDPLVYGEDANEFKPERMLDAEFARLNRDFPNCWKPFGNGKRGCIGRGFAWNEAVIA
MAILFQNFNFTLDDPNYQLEVAASLTIKPKDFFMRAQLRHGMTATELEQRLVGKGVPDEH
RADKKAAAEGGSKESQKPLAVYYGSNSGTCEALAQRVATDANSHGFKVTDLAPLDTAHQN
LPKDRPVIIVTASYEGLPPSNATHFVNWIENLKGNELEGVSYAVFGCGHHDWVQTFHRIP
KLVDSTLEQHGATRLIPLATTDAADSDMFSDFESWEDEALWPALKEKYGAAAGSSEGSAG
GFIVDVTLPRKSTLRQDVEEALVTDAKTLTTSGPAKKHIEIRLPTGMTYRSGDYLAVLPF
NPPDTVARVFRRFQLSWDAVLTIHSNQPTTLPTETPISANDVLRAYVELSQPATKRNISV
LAESTEDEQLKAQLEKLAGDDYQQEIGLKRVSVIDLLERFPSLNLPLDSYLAMLPPMRVR
QYSISSSPLADPAKLTLTYSLLEQPALSGQGSHFGVATHFLASLSAGDKLHVAVRQSKAF
HLPSDAENTPLIFIGTGSGVAPFRGFVQERAAMIAAGRKVAPALLFYGCRSPEVDDLYAE
EFERWEKLGAVEMRRAYSRAPEKSLGCKYVQHRMSHDREDLYRLWDQGAKVLVCGSRDVG
KAVEAVCVQLVQERVSAKGSEVTEEKARAWWDKQRNERYVTDVFD
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggctgagactgtccctattcctgagcctcctgggctgccgctgctgggcaacttgggc
gagttctctcagaaccccattgcggatatcattcgcctcgcagacacatatggcgaaatc
tacaggcttcacttgggcacccgtcccgccgtcttcgtcagcactcaggccctcgtcaac
gaatgctgcgatgagaagcgcttccaaaagtctctgagctctgtcctgcgaatcgtgcgt
gagggcgtccacgatggcttgttcacagctcactccgatgagcccaactggggcaaggcg
catcgcatcctgacgcccgcctttgggccgctccccatccgcgacatgttcgacgagatg
catgacatcagctcccagctggccctcaagatggctcgccatggccctcacgagccaatt
gccgtctctgacgagttcaccaagctagccctcgacaccatcgctctgtgttccatgaac
taccgcttcaactcgtactaccaggagaagatgcaccccttcgtccaggccatgagcgac
ttcctggccgagtgcagcaggcgcaacaggaggcccggctttgcccccaactttctgtac
cgcgctgccaacgaaaagttcttcaacgacattgccatcatgcgggacaccgccaacgcc
gtcgtggaggctcggaagaagaacccgtccgatcgcaaggacctgctcggcgccatgttg
aacgccgtggaccccctgacgggcgagaagctgagcgatgccaacatcaccgatcagctc
atcacctttttgattgccggccacgagacgacatcgggcatgatgtcgtttgccttttac
catctcctgaagaacccggatgcctatcgaaaagtccaagaggaggtggattcggtgctt
ggccgtgggccagccaaggtcgaccatgtctccaagctcacatatatccaggcagttctg
agagaaactctacgcgtcaccgccgcgatccccgccttctctgtcgaagccctcgaagac
accatcattggaggcaagtatctcgtccacaagggcgagcccatcagcctcgtcctcgcc
aaatcacacctcgaccccctcgtctatggcgaggatgccaacgagttcaagccagagcgc
atgcttgatgcagagtttgctcggctcaacagagactttcccaactgctggaagccgttt
ggtaatggcaaacgcggctgcataggaagaggctttgcttggaacgaggccgtcattgcc
atggccatcctcttccaaaacttcaacttcacgctcgacgatcccaactaccagctggag
gtggctgcgtctttgacaatcaagccaaaggactttttcatgcgagcccagctgcggcac
gggatgactgccacagagctcgagcagagactggtcggaaagggcgtccctgatgagcat
cgtgcggacaagaaggcggcggccgaagggggcagcaaggaatcccagaagcctctggcc
gtttactacggctccaacagcggcacctgcgaggcacttgcccagcgggtggcgactgat
gccaatagccacggattcaaggtgaccgacctcgctcccctggacactgcccaccagaac
cttcccaaggaccgcccagtgatcatcgtgacggcctcgtatgagggactgccgccttcc
aacgcgactcactttgtcaattggatcgaaaacctcaagggcaacgagctggaaggcgtc
tcgtatgccgtctttggctgcggccaccacgactgggtccagacctttcaccgcatcccc
aagctcgtggattcgaccctggagcagcacggcgccacccgcctcatcccgctggccacc
acggatgctgccgacagcgacatgtttagcgatttcgaatcatgggaggacgaggccctc
tggcctgctctcaaggaaaagtatggcgccgccgcgggctcttccgagggctcggccggt
ggcttcatcgtcgatgtaacgctccctcgcaagtcgacgcttcgccaggatgtcgaggag
gcgctcgtcaccgatgcgaaaaccctgacgacgagcgggcctgctaagaagcacattgag
atccgcttgcccacgggcatgacataccgatctggcgactaccttgctgtgctccccttc
aaccctccagacacagtagcccgagtgttccgtcgcttccagctttcctgggatgcagtc
ttgactatccactcgaatcagccgactacccttccgacagagacgcctatttctgcaaac
gatgtgcttagagcctacgtcgagctcagccagccagcaaccaagaggaatatctccgtc
ctggccgagtcaacagaagacgagcagctcaaggctcagcttgaaaagctggccggagac
gattaccagcaggagattggtctgaagcgtgtctccgtcattgacttgctggagaggttc
ccgtctctgaatctgcccctggactcgtacttggccatgcttccgcccatgcgtgtccgc
cagtactccatttcctcgtctcccctggccgatcccgcgaaactgaccctcacctactct
ctcctcgaacagcccgcactgtctggccagggctctcactttggagtggcgactcacttc
ctggcctctctcagcgccggcgacaagctccacgtcgccgtgcgccaatccaaggcgttc
cacctccccagcgacgccgaaaacacgcccctcatcttcatcggcacgggctccggagtg
gcacccttcaggggcttcgtccaggagcgggcagccatgattgcggcgggccgcaaggtt
gcccccgccctgctcttttatggatgccgctcgcccgaggtcgacgacctgtacgccgag
gaattcgagcggtgggagaagctgggcgccgtcgagatgcgcagggcgtactcgcgcgcg
ccagagaagtcgctgggctgcaagtacgtgcagcaccgcatgtcgcacgaccgcgaggac
ctataccggctgtgggaccagggcgcaaaggtgctggtctgcggcagccgcgacgtcggc
aaggcggtcgaggccgtttgcgtgcagctcgtgcaggagagggtctctgccaaggggtcc
gaggtcacagaggagaaggcgagggcgtggtgggacaagcagcggaatgagcgatatgtc
acggatgtgtttgactag

DBGET integrated database retrieval system