KEGG   Trichoderma reesei QM6a: TRIREDRAFT_22910Help
Entry
TRIREDRAFT_22910  CDS       T02991                                 

Definition
(RefSeq) alpha subunit of GDP-forming succinate-CoA ligase
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
tre  Trichoderma reesei QM6a
Pathway
tre00020  Citrate cycle (TCA cycle)
tre00640  Propanoate metabolism
tre01100  Metabolic pathways
tre01110  Biosynthesis of secondary metabolites
tre01130  Biosynthesis of antibiotics
tre01200  Carbon metabolism
Module
tre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TRIREDRAFT_22910
   00640 Propanoate metabolism
    TRIREDRAFT_22910
Enzymes [BR:tre01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     TRIREDRAFT_22910
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TRIREDRAFT_22910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 18484208
NCBI-ProteinID: XP_006967587
JGI: Trire2_22910
UniProt: G0RQT3
Position
Unknown
AA seq 330 aa AA seqDB search
MQAIPRTAARSALRNARRGYSTASSPYAKTIENLRINSETKVIFQGFTGKQGTFHASQAI
EYGTKVVGGTNPKKAGQTHLDLPVFKNVSEAVKETGATATALFVPPPLAAAGIEEALQAE
IPLAVCITEGIPQHDMVRITQMLKTQDKTRLVGPNCPGIIAPGQCKIGIMPGFIHKRGRI
GIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGTNFIDCLKVFLEDEETDGIIMIG
EIGGSAEEDAAEFLKQANTVNGGKPVVSFIAGISAPPGRRMGHAGAIVSGGKGGADSKIA
ALENAGVIVERSPAGLGKALYNEFVRRDLL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccattcctagaaccgccgcgcgctctgcgctgcgcaacgcccgccgtggctac
agcaccgccagctcgccgtacgccaagacgatcgagaacctgcgcatcaacagcgagacc
aaggtcatcttccagggcttcaccggcaagcagggaactttccacgcctcgcaagccatt
gagtacggaaccaaggtcgtcggtggaacaaaccccaagaaggctggccagacacatctc
gacctgcccgtcttcaagaacgtctccgaggccgtcaaggagacgggagctaccgctact
gcgcttttcgtcccccctcccctggccgccgccggtatcgaagaggctctccaggccgag
atccccctcgccgtctgcatcaccgagggaattcctcaacatgacatggtccgcatcacc
cagatgctcaagacccaggacaagacccgcctggtcggccccaactgccccggcatcatc
gcccccggccagtgcaagatcggcatcatgcctggcttcatccacaagcgcggccgcatc
ggcatcgtctcgcgttccggtaccctgacgtacgaggccgtcaaccagaccacccaggcc
ggcctcggccagtccctcgtcgtcggcatcggcggcgaccccttcagcggcaccaacttc
atcgactgcctcaaggtcttcctcgaggatgaggagacggacggcatcatcatgattggc
gaaattggcggttccgccgaggaggacgccgccgagttcctcaagcaggctaacactgtc
aacggcggcaagcccgtcgtcagcttcatcgccggcatctccgctccccccggccgccgt
atgggccacgccggcgccattgtctctggcggcaagggcggtgccgactccaagattgcc
gcgcttgagaacgctggcgtcattgtcgagcgctcccccgctggtctgggcaaggctctg
tacaatgagtttgtccgccgcgatctgctgtaa

DBGET integrated database retrieval system