KEGG   Trichoderma reesei: TRIREDRAFT_23346Help
Entry
TRIREDRAFT_23346  CDS       T02991                                 

Gene name
nag2
Definition
(RefSeq) glycoside hydrolase family 20, chitinase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
tre  Trichoderma reesei
Pathway
tre00511  Other glycan degradation
tre00513  Various types of N-glycan biosynthesis
tre00520  Amino sugar and nucleotide sugar metabolism
tre00531  Glycosaminoglycan degradation
tre00603  Glycosphingolipid biosynthesis - globo and isoglobo series
tre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TRIREDRAFT_23346 (nag2)
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    TRIREDRAFT_23346 (nag2)
   00531 Glycosaminoglycan degradation
    TRIREDRAFT_23346 (nag2)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    TRIREDRAFT_23346 (nag2)
   00604 Glycosphingolipid biosynthesis - ganglio series
    TRIREDRAFT_23346 (nag2)
   00511 Other glycan degradation
    TRIREDRAFT_23346 (nag2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tre03110]
    TRIREDRAFT_23346 (nag2)
Enzymes [BR:tre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TRIREDRAFT_23346 (nag2)
Chaperones and folding catalysts [BR:tre03110]
 Intramolecular chaperones
  Others
   TRIREDRAFT_23346 (nag2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 18484270
NCBI-ProteinID: XP_006969176
JGI: Trire2_23346
UniProt: G0RVI0
Position
Unknown
AA seq 603 aa AA seqDB search
MICRAILAALALSSPASALWPVPKHSSTGNVTLFIDQTVQVTYNGEQVRWALGADDDAGF
RDYAETRIDNQQVAYTAGYVPPSGPHFTSRDIVQGGLSRTFGAIFQQGFVPWMLRERDSE
FEPGLGGSRIRTLQIIQTQHDSPDTFKPLTGSVNESYALDVDAKGHASIVAPSSTGILRG
LETFSQLFFKHSSGTAWYTQLAPVSIRDEPEYPHRGLLLDVGRHWFEVSDIKRTIDALAM
NKMNVLHLHATDTQSWPLEIPSLPLLAEKGAYHKGLTYSPSDLASVQEYGVHRGVQVIVE
IDMPGHVGIDKAYPGLSNAYGVNPWQWYCAQPPCGSFKLNNTDVEKFIDKLFDDLLPRLS
PYSAYFHTGGDEYKANNSLLDPALRTNDVKILQPMLQRFLDHTHKKVRELGLVPMVWEEM
ILDWNATLGKDVVAQTWLGQGAIQKLAEAGHKVIDSSNQFYYLDCGRGEWLDFANGAPFN
NNYPFLDWCDPTKNWKLMYSHDPTDGVSDDLKKFVIGGEVAVWTETIDPTSLDTIIWPRA
GAAAEIWWSGKTDEHGANRSQIDARPRLSEQRERMLARGVRGTPITQLWCSQVDVHNCES
GNY
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcagggctatcctcgccgcactggcccttagcagcccggcctccgctctgtgg
ccggtgccgaagcactcctcgaccggcaacgtcacgctcttcattgaccagacggtccag
gtcacgtacaatggcgaacaggtgcggtgggctcttggtgctgatgatgacgctggattc
cgggactatgctgagaccaggatcgataaccaacaggtcgcctacacggccggctatgtg
ccgcccagcggacctcacttcaccagccgcgatatcgtccagggcgggctctcgcgcact
tttggcgccatcttccagcagggcttcgtgccgtggatgctgcgggagcgagactcggag
ttcgagccgggcctcggtgggtcgcgcatccggacgctgcagattatccagacgcaacac
gacagccccgataccttcaagcccctaaccggctctgtgaacgagtcgtatgcgctggac
gtcgatgccaagggccacgcctccatcgttgcgccgtcgtcaactggaatccttcgcggt
ctggagacgttttcgcagctcttcttcaagcacagctctggaactgcctggtatacgcaa
cttgcgcctgtttcgatccgcgatgagccggaatatcctcaccgcggtcttctgctggac
gtgggccgccactggttcgaggtctctgacattaagcgaacgattgatgccttggccatg
aacaagatgaatgtgctgcatctgcacgcaactgatacgcagtcgtggccactggagatt
ccatctctgcccttactggccgagaagggcgcctatcacaagggcctaacttattctccg
agtgatctcgccagcgtgcaagagtacggtgtccaccgaggcgtccaggtcatcgtggag
attgacatgcctggccacgttggcattgacaaagcttatcccggtctgagcaacgcatac
ggcgtgaacccatggcaatggtactgtgcacagcctccttgcggctcgtttaagctgaac
aacaccgatgtcgagaagttcatcgataagctgtttgacgatttgctgccgcgcttgtca
ccatactcggcctattttcacactggcggcgatgaatacaaggcgaacaactcgctgctc
gatccggcactgcggacaaatgacgttaagatccttcagccgatgttgcagcgattccta
gatcacacacacaagaaagtgcgtgagttggggctcgttcccatggtctgggaggagatg
atcctggactggaacgcgactctggggaaggatgttgttgcgcagacgtggctcggtcaa
ggagcgattcagaagctcgcggaagctggacacaaagtgattgacagcagcaaccagttc
tactatcttgactgtggtcgtggagagtggctcgatttcgccaacggcgcccccttcaac
aataactaccccttcctcgactggtgcgacccgaccaaaaactggaaactcatgtactct
cacgaccctacagacggtgtatccgacgacctcaaaaagttcgtcatcggcggcgaggtt
gctgtttggaccgaaaccattgacccgactagtttggacaccatcatctggccgcgagca
ggagcggcggccgagatctggtggtcgggcaagacggacgagcacggcgcgaatcgatcg
cagattgacgcccggccgagactgtcggagcagcgggagaggatgctggccagaggggtg
agagggacgccgattacacagttgtggtgcagtcaggttgatgtgcacaactgcgagtcc
gggaactactga

DBGET integrated database retrieval system