KEGG   Trichoderma reesei: TRIREDRAFT_50913Help
Entry
TRIREDRAFT_50913  CDS       T02991                                 

Definition
(RefSeq) hypothetical protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
tre  Trichoderma reesei
Pathway
tre04111  Cell cycle - yeast
tre04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tre00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    TRIREDRAFT_50913
   04113 Meiosis - yeast
    TRIREDRAFT_50913
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tre01002]
    TRIREDRAFT_50913
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tre03036]
    TRIREDRAFT_50913
Enzymes [BR:tre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     TRIREDRAFT_50913
Peptidases [BR:tre01002]
 Cysteine Peptidases
  Family C50: separase family
   TRIREDRAFT_50913
Chromosome and associated proteins [BR:tre03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    TRIREDRAFT_50913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT TPR_12
Motif
Other DBs
NCBI-GeneID: 18485352
NCBI-ProteinID: XP_006968047
JGI: Trire2_50913
UniProt: G0RRT6
Position
Unknown
AA seq 2063 aa AA seqDB search
MASLQAKVEAVKATVASTATCTPATVVTLKELLLPEAESQPPRPKPTASRSTKAGAATKT
KGSTAREDSLVSHGETLSARERAALATYIINVTLKTLSEAAKPQPLATPSKPAGDPREAA
GIQSIRRSSSAPLSPVQPRALNRLTASFSVEANITKSQSPAQSTGCLATVECARTAFSAL
RTMKGPTKPDETDFQLETGMSALAGKLLSLGMHDQALKELRVLKRRLDTIINGKQSSNAK
SGSESTTTTSAIADLLNFHGSIPKQSLATITGYQMQVLKLVAATKKPSHIEAILPYLPDS
YTSSPFNLLSALAKGGAKEASKAVRQMASLSQLLLSLAPSISSQEDAVATEPRLSPSPRA
AFELQSLAFRIQLKWWKLAGHQGKIDNDVLSPFSRCLRAYTRRQRSDDGPIYQRVSEAYD
AIMQLIHAQQYRPATSFDFPLASIHQNLGSIAQAERRYTEAHRWFLEVKGSLTAGHESSV
LRCSVSARLLAVALKKSDLDQTVEPLLCEVIEGLDGSLSGTIAELNELLESLCLARRSVV
GLLMTCLGPKAAESTVPNILLGHLKTFALKYPRFVRRWTGLPPGKDAPPKQVLQFDQRRQ
LVAQSIGQTLDATLMVIKCDIQSESLEWHAVDDVLQHCVSLIECMTASTLSTHKVDNFGP
YSVKLSSLYFLYFSQLKRKSSRTKDENKHLLQALHRSIDVVKNCTEAEKEKAQLSTKLEV
FADLCKSSGRADDAIQALRAICSNMADKGALSDVAEALSVQPPSTAWAINERVSLMSRTL
RSLSKYDTSWNEWTFPLPEAERAAVLEHLMYLNLSGSSTPLGLHDAGVAALLRLYTPDRY
PLRRLRVLLHLCYQNLGEEEQLAQILPLAEETLERVETGDKAGDAALARFVPHLKAYCFS
ISALIRVDYTMTPLLDQAIDSWKSMVGTCQTQDELLSIIDDPQGLLDHLRSLHQLAGLRG
ETRLQLAISELTISLSSIFVGSTEANGDGLVLSHSHLAAQYVQIGLFPQALKTLEETQEL
ISRYDGLSRQVQAEFHLSQAEYHTSIGEMETAKICNAHYSSWARSKSQASMIMSITALLQ
SIATLQAGHIPDALSYVKTSVRLLTHDWTKLEAAMGAGPRNAADMSLSDMNTSITDLTTS
RGKASGPRFWALASPLLRSLLHISSVYAHIGMFQETIYYAESAWKIAESTQSSLYKSQVA
IWIGSVYLRAGKLPKALATFKNAEEQLPRDICSARVRFARQLGEFYWEIGEDDKAAGYLT
IAEETARLLSTVEGESSSNVDAEPPIASTRATRSTRATRAKAATGSTKASKRDTAETKAP
PLEDAVQLPKDIYYASLHAAIIMSRTLGLIHQKDWTSALQALEQLKDVPKLVAVLSQEQV
MTAVSLIGHSMEQMTSDPVFSVMQDSTISFPAVSALALASPIKQPLVKGEKETDSPAFAD
ALRQAQELLVEAHASALSSADSSMVRRISTLLQSTLIFLSATLASSRCLSGSSLGTIAVD
MARNVTWRREQLTLAGPNNDAAAMRVATPVHKPPAAELTADMANFQESYVDLIPEKWSVI
SVSLSDNRHDLCITKFQAGQGPFILRLPLERANSRDADSEVFNFEHGREELLELIKLANE
SSHSARDFTAKGERGAWWAERQALDSRLKKLLVTIETTWLGGFKGIFSQHRRLGDLLARF
QRDFHQMLDRTLPSRNKSRAKKMTTKTDTVNLDPRILDLFIGLGNPTDPDTDFDEAMNDL
LYFVVDILQFHGERNAYDEIDFDSMVLETYDALRAYHNAASSPEREEGAHTVLVLDKLLH
AFPWESLPCMDGLSVSRVPSLACLRQLIEEAGIGPTSASQGHFVSARAGTYVLNPSSDLT
NTQAFFQSAFLSLESWTGITNKAPKESEFEHALSTSEIMVYFGHGSGAQYIRGKTIRRLE
KCRPATFLMGCSSAALTDAGEFELYGPVWNYMMAGCPAVVGTLWDVTDRDIDRFAGRAFE
EWGLFARGTFDLSTSLSGKAKAKAKGRAKSFAEEVDQVRLDAPASDHASLAEAVARARSA
CRFKYLNGAAVVLYGIPVYIKKE
NT seq 6192 nt NT seq  +upstreamnt  +downstreamnt
atggcttccttacaggccaaagtcgaggccgtcaaggcgactgttgcatcgacagcgact
tgcactccggcgacagtcgtaacactcaaagaactcctcctgccagaagccgaatcgcag
ccgccgagaccaaagcccaccgcctcacgatctacaaaggctggagccgcgacgaaaacg
aagggcagcaccgcaagagaagattccctggtctcccatggcgagacgctgagtgcgcgc
gagagggctgccctggccacatacatcattaatgtcaccctcaagacgctgtccgaggct
gcgaagcctcagcctttggcaacgccgtcgaaaccagccggcgatcctcgagaagcagcg
gggatacaatcgatacgcagatcctcctcggcgccgctgtctcccgtccagccccgcgcg
ctcaaccgccttactgcgtccttcagcgtcgaagcgaacattacgaaatcacaatcgcca
gcccagtcgacgggatgtcttgccacggtggagtgcgcacgaaccgcattctccgcgctc
cgaaccatgaagggcccaacgaaacccgacgagaccgactttcagctggagacgggcatg
tcagcattggcaggcaagctgctctctctggggatgcatgaccaagctctcaaggagctg
agggtgctgaagcgaaggttggataccatcatcaatgggaagcagtcaagcaatgccaag
tcgggatccgagagcacgaccacgacatcagcaatcgccgatttgctcaacttccacggc
tccattccgaagcagagcctcgccaccatcacgggataccagatgcaagttctgaagcta
gtcgcggcgacgaagaagccctcccacatcgaagccattctcccctacctccccgattca
tacacctcgtctccgttcaacctcctgtccgccctcgccaaaggtggagccaaggaagcc
tcaaaggcggttcgccaaatggcgtccttgtcccaacttctcctctcgcttgcgcccagc
atctccagccaggaagatgccgtagccaccgagccccggttgagtccgtctccccgagca
gctttcgaactgcagtctctggctttccggattcagctcaagtggtggaaattggcgggc
catcagggaaagattgacaacgacgtgctctcgccgttctctcgctgcctacgagcttac
acccgccgccagagatcagacgacggccccatctaccaaagagtgtccgaagcatacgac
gccatcatgcagcttattcatgcccagcaatatcgtccagcaacatcctttgacttccct
ttagcatcaatacaccaaaatctagggtccattgcccaggctgagcgccgatataccgaa
gcccaccgctggtttctggaagtgaagggctctcttactgccggacacgaatcatctgtt
ctcagatgctcggtgtctgcgcgcctccttgcggtggctctgaagaagtccgatctagat
caaacggtcgagcctctgctctgcgaagtcatcgagggcttggacggcagcctcagcgga
acaatcgcagagctgaacgagcttctcgaaagcctgtgtcttgcgaggcgctcagtcgtc
ggcctccttatgacctgcttgggcccgaaagcagccgaaagcacggttccaaacatccta
ctaggtcatctcaagacattcgccctcaagtatccacgatttgtgcgccgatggacagga
ctgccccctggcaaagacgcaccgccgaagcaggtcctccagtttgatcagcggcgacaa
ctagttgcacagtccataggtcaaactcttgatgctaccctcatggtcatcaaatgcgac
atccagtccgaatctttagagtggcacgcagtcgacgatgttcttcagcactgcgtctcc
cttatcgaatgcatgactgcctctactctgtctacccacaaagtggacaatttcggcccc
tattccgtcaagctctccagcctttactttctctacttttcccagcttaaaaggaaatcg
agccgaaccaaagacgagaacaagcaccttctgcaggccttgcaccgatcgattgacgtt
gttaagaactgtaccgaagcagagaaggagaaggcgcagctatcaacgaagctggaggtg
tttgccgatctgtgcaaaagttctggcagggccgacgatgccatacaggcgttgcgcgcc
atctgctccaacatggccgacaagggcgcgctgagcgatgttgctgaagcgctctctgtc
cagcctccaagcacggcctgggccatcaacgagagggtatcgctcatgtcgcgcactctg
cgctccttgtccaagtatgacacctcgtggaacgagtggacgtttcccctcccagaggct
gaacgcgccgcggtcttggagcatctcatgtatctcaatctctctggttcctcgacaccc
cttgggcttcacgatgcgggagtcgctgcgctgcttcgcctgtacacccctgacaggtat
ccactgcgccgcctccgcgtgttgctacatctctgctatcaaaaccttggagaagaggaa
cagcttgcccaaatcctccctctagctgaagagacgctggagcgtgtcgagaccggagac
aaggcgggcgacgctgcactggcccgctttgttccccatctaaaggcctattgcttttcc
atttctgctctcatccgtgtggattataccatgactccgctgcttgatcaggcaatcgac
tcctggaagtccatggtagggacttgtcagacgcaagacgagctgctttcaatcatcgac
gaccctcagggcctgttggatcatctgcggtcactacaccagcttgcagggctcagggga
gagacgcgtcttcagcttgccatatctgagctcaccatttccctgtctagcatatttgtc
ggatctacggaagccaacggcgacgggctggttctcagccatagtcatttggcggcgcaa
tacgtacagattgggctattcccgcaagctctcaagaccttggaggaaactcaagagctc
atcagccgctatgacggactctctcgtcaagtccaagctgagtttcacctctcacaggca
gagtaccacaccagcattggcgagatggagactgccaaaatttgcaacgcccattactcc
tcttgggctcggagcaagtctcaggcttcaatgatcatgtccatcaccgcattgctacaa
tccattgctactctccaggctggacatataccagacgcgctctcatacgtcaagacaagc
gttcgattactcactcatgactggaccaagctggaagcagcaatgggggctggcccaagg
aatgcagcagacatgagcctgtcagacatgaacaccagcatcacagacttgacaacctca
cggggtaaagcatccggcccgcggttctgggctctggccagcccacttcttcgaagcctt
ttacacatctcgtcagtgtacgctcatatcggcatgttccaggagacaatctattacgcc
gagtccgcctggaagattgcggagagcacccaatcatccctctacaaatctcaggtagct
atctggatcggctcagtctatcttagggctgggaagctgccaaaagcgctggccactttc
aagaatgcagaggagcagctaccgcgtgacatctgctctgcccgcgttcgctttgcgcgt
caactcggagaattctattgggagattggagaagacgacaaagctgccgggtacctgaca
atcgctgaggagactgcccgccttctgagcacagtcgagggcgagtctagtagcaatgtc
gatgcagagccccctattgcctcgaccagggctacaagatccacgagagcaacgagggca
aaagcagcaacaggctcaaccaaagcctcgaagcgtgacacggcggaaaccaaggctcct
cctctagaggatgctgtacagctgcccaaggacatatactatgcctccctccacgctgcc
atcatcatgtcacgcaccctgggcctgatccatcagaaagactggacgtcggctctgcaa
gcgctagaacaactcaaagacgtccccaaactcgtggccgtgctttctcaggaacaagtc
atgacagcggtgtcgttgattggccacagcatggagcagatgacttccgatcccgtcttc
tctgtcatgcaggattcaaccatttccttccccgctgtgtcggcgctggctctagcctct
cctatcaagcagccgcttgtcaagggcgaaaaggagacggactctcctgcctttgccgat
gcgctgaggcaagcacaggagctcctcgtcgaagctcacgcctctgccctctcgagcgct
gacagcagcatggttcgtcgcatctccacactgctccagagcaccctcatctttctctcg
gccacactggcttcgtccaggtgtctctctggatcgagcttgggcactatcgctgttgac
atggctcgcaatgtcacctggcggcgagagcagctgacgctggccggacccaacaatgat
gcggccgctatgcgggttgcgactccagtccacaagccgcccgcggcagagttgacggcc
gacatggccaactttcaggagtcctacgtcgacttgattccagagaagtggagcgtcatc
tctgtttccctcagcgataaccgccatgatctgtgcatcaccaaatttcaagctgggcag
ggcccgttcatcttacgcttgcccctggagcgagccaactcccgtgatgccgactctgag
gtcttcaactttgagcacggtcgtgaggagctgctggagctgatcaagctggccaacgaa
agcagccactccgcgcgggacttcaccgccaaaggagaacggggtgcttggtgggcggag
cgacaggctctcgactctcgacttaagaagctcttagtcacaatcgagacgacttggctg
ggagggttcaagggcatattctcgcagcatcgcagactgggggacctgctggcacgcttc
cagcgggatttccaccaaatgctggacaggactctgccttctcgaaacaagagccgagcc
aagaagatgacgacgaagacggatacggtaaacttggatcccagaattctcgacttgttt
attggcctcggcaaccctaccgacccggacaccgactttgacgaggccatgaatgacctg
ctctactttgtggtggatatcctgcagtttcacggcgagcgaaatgcttacgacgaaatc
gattttgacagcatggtgctagagacgtacgatgccctgcgcgcatatcacaatgctgcc
agctctccagagagagaggagggcgcgcacacggtgcttgttctcgacaagctgctgcat
gctttcccctgggagtcgctgccctgcatggacggcctctcggtgtctcgggtgccttca
ctcgcatgtcttcgtcagctcattgaggaggctggcataggtccgacaagcgcatcacag
ggccactttgtgtcggccagggctggcacatacgtcctcaatccgtcgtctgacctgacc
aacacgcaagccttcttccagtcggccttcttgagtcttgagtcgtggaccggcatcacc
aacaaggcgcccaaggagtccgagttcgagcacgcgctgtccacgtccgagattatggtg
tactttggccacggcagcggcgctcagtatatccgtggcaagacgatccgccgcctggaa
aagtgcaggccggcgacgttcctcatgggctgcagctctgcggctctcaccgacgcgggc
gagtttgagttgtatggccccgtgtggaactacatgatggccgggtgtccggccgtcgtg
ggcacgctgtgggacgtgacggaccgcgacattgaccggttcgccggcagggcttttgag
gaatgggggctctttgccaggggcacgtttgacctgtcgacgtccttgtcgggcaaggcc
aaggccaaggccaagggcagggctaagagctttgccgaggaggtggaccaagtgaggctc
gatgctcctgcttcagatcatgcttcgcttgcggaggcggtggcgagggcgagaagcgcg
tgtcgcttcaagtatctcaacggcgcggcggtggttttgtatggaatccctgtttatatc
aagaaggagtga

DBGET integrated database retrieval system