KEGG   Trichoderma reesei QM6a: TRIREDRAFT_60418Help
Entry
TRIREDRAFT_60418  CDS       T02991                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
tre  Trichoderma reesei QM6a
Pathway
tre00010  Glycolysis / Gluconeogenesis
tre00053  Ascorbate and aldarate metabolism
tre00071  Fatty acid degradation
tre00280  Valine, leucine and isoleucine degradation
tre00310  Lysine degradation
tre00330  Arginine and proline metabolism
tre00340  Histidine metabolism
tre00380  Tryptophan metabolism
tre00410  beta-Alanine metabolism
tre00561  Glycerolipid metabolism
tre00620  Pyruvate metabolism
tre01100  Metabolic pathways
tre01110  Biosynthesis of secondary metabolites
tre01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRIREDRAFT_60418
   00053 Ascorbate and aldarate metabolism
    TRIREDRAFT_60418
   00620 Pyruvate metabolism
    TRIREDRAFT_60418
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TRIREDRAFT_60418
   00561 Glycerolipid metabolism
    TRIREDRAFT_60418
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TRIREDRAFT_60418
   00310 Lysine degradation
    TRIREDRAFT_60418
   00330 Arginine and proline metabolism
    TRIREDRAFT_60418
   00340 Histidine metabolism
    TRIREDRAFT_60418
   00380 Tryptophan metabolism
    TRIREDRAFT_60418
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRIREDRAFT_60418
Enzymes [BR:tre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     TRIREDRAFT_60418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 18486619
NCBI-ProteinID: XP_006964798
JGI: Trire2_60418
UniProt: G0RHB4
Position
Unknown
AA seq 493 aa AA seqDB search
MLTLTIKTPVITYTQPLGLFIDGQWVEGVRGKTFDTINPTTEQPIVAVHEAGPEDVEIAV
RAARKAFTGIWSRTSPTDRGKLLVKLAELFEEHSDVLAAIESLDNGKALSLSKVDVKIAA
ETLRYYGGWADKINGKTIDTDHEHFTYTRHEPIGVCGQIIPWNFPLVSLTMKIGPALACG
NTVVLKTAEQTPLSGLYAATLMQKAGIPAGVINVLSGFGLTAGAAIAAHTDIDKISFTGS
TAVGRSILQAAAASNIKKLTLELGGKSANIVFNDADVEEAVTWAHLGIFWNHGQVCCAGS
RIYVQSRIYDDFIKTFKARASAVVIGDPFDQDTFQGPQISKVQYDRIMDYIQSGIEDGAV
VEVGGKRHGTKGYFIQPTIFSNVSRDMSIMREEIFGPVCVICKFETEQEAIELANDSNYG
LAAAIHTTDINTSIRVSNKLKAGTVWVNTYNSLSYQVPFGGFKESGMGREMGEYALSDYT
QVKSVRIRLKSNL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgctgaccatcaaaacccctgtcatcacatacacccaaccactgggcttgttt
attgatggtcagtgggtggagggtgtccgagggaaaacattcgacacaattaatcccacg
accgagcagccgatcgtagccgttcacgaagccggcccagaagatgttgagattgctgtc
agagcagcgcgcaaagccttcactggtatctggtcaagaacgtctcctacagatcgaggc
aagctccttgtgaagttggcggagctcttcgaagaacactcggatgtcctggcagcaatc
gaatccctagacaatggaaaggcgctgtccctgtccaaggtcgatgtcaagatagcggct
gagaccttgagatactatggcggctgggccgataagatcaacggcaagacaatcgatacg
gaccacgagcacttcacctacacaaggcatgagccaattggcgtttgtggccagataatc
ccgtggaatttcccgctggtttctcttaccatgaaaatcggcccggcacttgcctgtggg
aacactgttgttctgaagactgcagaacagacccctctgtctggcttatacgcagcaacc
ttgatgcaaaaagcaggtattcccgctggtgtaatcaacgttctctcgggtttcggtctc
acagccggtgcagccattgcggctcacacagacattgacaaaatctccttcactggttcg
actgccgttggccgaagcatattacaagccgcagccgcatctaatatcaagaagctgact
ctagaacttggtggcaagtcggccaatattgtctttaacgacgctgatgtcgaagaagcg
gtcacatgggcccacctggggatcttttggaatcacgggcaagtgtgctgtgctggatcg
aggatctacgtccaatcacggatatatgacgactttatcaagacgttcaaggctcgagca
tctgcggtcgtcattggtgatccattcgaccaggacactttccagggacctcaaatcagc
aaagtccagtatgaccgcatcatggattacattcagtccgggatagaagacggagcagta
gttgaggtcggcggtaagcgccacgggaccaagggttacttcatccaacccacaatcttc
tcaaatgttagtcgggacatgagcatcatgcgagaggaaattttcggccctgtctgcgtc
atttgcaagtttgaaaccgaacaagaagcgattgagttggccaatgactccaactacggg
ctcgctgccgcaatacacaccacggacatcaatacatcaatccgcgtgtctaacaaactc
aaggcagggactgtctgggtgaacacgtataactcattaagttaccaagttccgttcggt
ggcttcaaagaatcaggaatgggtcgagaaatgggggagtatgctctcagcgactacact
caggtcaagtcggttcgcatcaggttgaagagtaatttgtga

DBGET integrated database retrieval system