KEGG   Trichoderma reesei QM6a: TRIREDRAFT_68444Help
Entry
TRIREDRAFT_68444  CDS       T02991                                 

Definition
(RefSeq) hypothetical protein
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
tre  Trichoderma reesei QM6a
Brite
KEGG Orthology (KO) [BR:tre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tre01009]
    TRIREDRAFT_68444
Enzymes [BR:tre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     TRIREDRAFT_68444
Protein phosphatases and associated proteins [BR:tre01009]
 HAD phosphatases
  Other HAD phosphatases
   TRIREDRAFT_68444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase
Motif
Other DBs
NCBI-GeneID: 18487710
NCBI-ProteinID: XP_006968758
JGI: Trire2_68444
UniProt: G0RU27
Position
Unknown
AA seq 225 aa AA seqDB search
MGIPDSTNSDVFHDWAQLPISREQFARESREQMHKLFPNCEPLPGAEKLLSNLSRARSAS
LGKPIELALASSTRTHSYQLKTSRPETKRLLDFFQPHKRILGDNPRVPKGRVKPAPDIYL
LALETLNSAIGPDESPILPSECLVFEDSIIGVEAGRRAGMRVIWVPHPDLAAEYQDRVKL
VLAGRTGLIEIGDEWQLGEIDDGWAECIPSLEHFDYGKYGIEVPL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggcatacccgactccaccaacagcgacgtcttccatgactgggcacagctgcccatc
tctcgcgagcaattcgcgcgcgaatcaagggagcaaatgcacaagctttttccgaactgt
gagccgttgcccggcgcagagaagctcttatcgaatctcagccgggcacgaagtgcttct
ttggggaagccgattgagctggcattagcgtcgagtactaggactcacagctaccagctg
aagacatcacggccggaaacgaaacgacttctcgacttcttccagccacataaacgcata
ctgggcgacaatccgcgcgttcccaaggggcgagtgaagccagcacccgacatctacttg
cttgctctagagactctcaactcagccattggtcctgacgaatcacctattctgcccagc
gagtgtttggtctttgaggacagcatcattggggtcgaggctggaagaagggcaggtatg
agggttatctgggtcccccatccagatctggcggctgagtaccaagacagagtaaagctt
gtgcttgccgggaggacggggctgatcgagattggagacgagtggcagcttggagagatc
gatgacggttgggctgagtgtatcccgagcttggagcactttgactacggtaaatatggc
attgaggtgccgctctaa

DBGET integrated database retrieval system