KEGG   Trichoderma reesei QM6a: TRIREDRAFT_68608Help
Entry
TRIREDRAFT_68608  CDS       T02991                                 

Gene name
thi4
Definition
(RefSeq) thiazole biosynthetic enzyme
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
tre  Trichoderma reesei QM6a
Pathway
tre00730  Thiamine metabolism
tre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    TRIREDRAFT_68608 (thi4)
Enzymes [BR:tre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     TRIREDRAFT_68608 (thi4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO Lycopene_cycl NAD_binding_8 NAD_binding_9 Pyr_redox_2 FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 18487732
NCBI-ProteinID: XP_006968797
JGI: Trire2_68608
UniProt: G0RTZ3
Position
Unknown
AA seq 324 aa AA seqDB search
MSPPAAVSPPQRTAELVTPSKMAVAQPQQHLEAQAKSVSDMFGQWDSFTFSPIRESQVSR
AMTRRYFEDLDRYAESDIVIIGAGSCGLSTAYVLGTQRPDLKIAIIEASVSPGGGAWLGG
QLFSAMVMRKPADAFLREIGVPYEDEGNYVVVKHAALFTSTIMAKVLQLPNVKLFNATCV
EDLITRPSAEGVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPLVISTTGHDGPMGAFCVK
RLVSMGRIEKLGGMRGLDMSRAEDAIVKNTREVVPGLIVGGMELSEIDGANRMGPTFGAM
ALSGVKAAEEALKVFEARRKENAQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagccctcccgccgccgtctcgcccccccagcgaaccgctgaactcgtcaccccgtcc
aagatggccgttgcccagccgcagcagcacctcgaggcccaggccaagtccgtctcggac
atgttcggccagtgggactcgttcaccttctcgcccatccgcgagtcccaggtgtcgcgc
gccatgacccgccgctacttcgaggacctcgaccgctacgccgagtccgacattgtcatc
atcggcgccggctcctgcggcctcagcaccgcctacgtcctcggcacccagcgcccggac
ctcaagattgccatcatcgaggcctccgtctcccccggcggcggtgcctggctgggcggc
cagctcttctccgccatggtcatgcgcaagcctgccgatgccttcctccgcgagattggc
gtcccgtacgaggacgagggcaactacgtcgtcgtcaagcacgccgccctcttcacctcc
accatcatggccaaggtgctgcagctacccaacgtcaagctcttcaacgccacctgcgtc
gaagacctcatcacccgcccctctgccgagggcgtgcgcatcgccggtgtcgtcaccaac
tggaccctcgtctccatgcaccacgacgaccagtcctgcatggaccccaacaccatcaac
gcgcccctcgtcatctccaccaccggccacgacggccccatgggtgccttctgcgtcaag
cgccttgtcagcatgggccgcatcgagaagcttggcggcatgcgcggcctcgacatgagc
agggctgaggatgccattgtcaagaacacccgtgaggttgttcccggcctgattgtcgga
ggaatggagctgtctgagattgacggagccaaccgcatgggtcctacctttggtgccatg
gccctcagcggtgtcaaggctgccgaggaggctctcaaggtctttgaggcccgccgcaag
gagaatgctcagtaa

DBGET integrated database retrieval system