KEGG   Trichoderma reesei QM6a: TRIREDRAFT_69291
Entry
TRIREDRAFT_69291  CDS       T02991                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
tre  Trichoderma reesei QM6a
Pathway
tre00910  Nitrogen metabolism
tre01100  Metabolic pathways
Module
tre_M00531  Assimilatory nitrate reduction, nitrate => ammonia
tre_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    TRIREDRAFT_69291
Enzymes [BR:tre01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     TRIREDRAFT_69291
SSDB
Motif
Pfam: NIR_SIR Fer2_BFD NIR_SIR_ferr Rieske_2 Rieske
Other DBs
NCBI-GeneID: 18487819
NCBI-ProteinID: XP_006969167
JGI: Trire2_69291
UniProt: G0RV98
Position
Unknown
AA seq 653 aa
MGKPIEKPPSEFIIGAARDGEEEGDDLPLDAQVCSCHNVSKGNIVECVKTGGVRSFGEMK
SSTKCGMGCGGCVPLATSIFNRALQDAGVEISNHICKDFAYSRQDLYQIAKFRKLKDFTT
MMRAVGKRPDGLGCEVCRPAIGSILSSLYNENIMKPSMRQTQDTNDRYLANVQRDGTYSV
VPRLPAGEITPKGLKVIGEVADRFGLYTKITGGQRIDMFGAKKQDLPQIWELLINAGFES
GHAYGKALRTVKSCVGNTWCRYGVGDSVGLAVELENRYKGLRAPHKFKGGVSGCVRECAE
AQGKDFGLIATPKGWNVFVGGNGGAKPRHAELLVEDVTRREAMRILDRFLIFYIQSADKL
ERTARWIEKYPGGLRGIKEVIVDDKLGICADLEKEMEALVGSYHCEWTNVVSSQERRKAF
RQFANTDETQVVSEQVTKRAQKRPVDWPEDISPLHFSLQNIAKDAKWDWQIVCKLSELNR
QIDAPTSVTVKYGEVQLAVWNIPGRGLRASQNMCPHKKAFVLADGLIGEDEHGREYVSCP
LHKRNYLLESKGGTGGGGSCSDTNYSIMTFEAKADEQNDAILIYLPPTEALDAVLSTARW
MLRKADGEVKFLVKDAEPSIEIAEPRVPGKMRSQLSHTAAFQPCGGGGNALEW
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgggcaaacccattgagaagcccccatctgagtttattatcggagcagcaagagatgga
gaggaggaaggagacgacttacctcttgatgcccaagtatgcagctgccataacgtcagt
aaaggcaatatcgtggagtgtgtaaagactggtggtgttcgttcctttggggagatgaaa
tcctcaacaaagtgtggcatgggttgcggaggctgcgtgccattggctactagcatcttc
aaccgcgcacttcaggacgccggcgttgagatctccaaccacatctgcaaggattttgcc
tattcacgccaggatctttaccagattgccaagttcagaaagctcaaggactttacaaca
atgatgcgcgctgtcggcaagaggcctgatggtctcggctgcgaagtttgcagaccagcc
atcgggtcgattctgagttctttgtacaacgaaaacatcatgaagccctccatgcgccag
acgcaagatacaaacgatcgttatctcgccaatgtgcagcgagacgggacttattcagtt
gttccgcgactacctgcaggcgaaatcacaccaaaggggctcaaggtcattggagaggtc
gcagacaggttcggactctacaccaagatcactggcggccagcgtatcgacatgtttggt
gcaaagaagcaggacctcccgcaaatttgggagctgctcatcaatgctggctttgagagc
ggccatgcttatggcaaagcgctgcgaacagtcaagtcttgtgtcggcaacacttggtgc
cgttacggcgtaggcgattcagttggtctcgccgttgaactggagaatcgctacaagggc
ttgcgtgctccccacaagttcaagggcggtgtatctggttgtgtgagggaatgtgcagaa
gcacagggcaaagactttggtctcattgccacccccaaaggttggaatgtgtttgtgggc
ggaaacggcggcgcaaaacctcgccacgctgaactacttgtcgaggacgtgactagacgt
gaagcaatgagaattctcgatcgctttctcatattttacattcagtcagcagacaaactc
gaaagaaccgctcgctggattgagaaataccccggcggcctcaggggcatcaaggaggtc
atcgttgacgacaagcttggcatatgcgcggacctggaaaaagagatggaggcactcgtt
ggctcgtatcactgcgagtggaccaacgtggtcagtagtcaggagcgccgcaaggctttc
agacaatttgccaatacggatgagacgcaggtggtatccgagcaagtcacaaagcgcgcc
cagaaacgtcccgtggactggcccgaggatatctcccctctgcacttcagcttgcagaat
atcgcaaaggatgcaaagtgggattggcagattgtctgcaagctttctgagttgaaccgt
cagattgacgcaccgacatcggtcactgtcaagtatggcgaagttcagctggctgtgtgg
aatatcccgggccgtggcttgcgcgcttcacagaacatgtgcccgcacaaaaaggcattt
gtgctggcagacggcttgataggtgaagatgagcatggacgggaatacgtatcatgtcca
ctgcacaagagaaactacctgctcgagtccaaaggggggacggggggaggtggaagctgc
tcggatacgaactattccatcatgacattcgaggccaaggcagatgagcagaatgatgcg
atactcatctatcttcctcctacagaagcactggatgctgtcctttcgacagccagatgg
atgctgcgaaaggcagacggagaagtgaagttcttggtcaaggatgctgagccatcaatc
gagatcgcagagcctagggttcctgggaagatgagatctcagttgtcacataccgctgcc
tttcaaccctgtggcggcggcggaaatgcgcttgagtggtaa

DBGET integrated database retrieval system