KEGG   Trichoderma reesei QM6a: TRIREDRAFT_80920Help
Entry
TRIREDRAFT_80920  CDS       T02991                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tre  Trichoderma reesei QM6a
Pathway
tre00010  Glycolysis / Gluconeogenesis
tre00071  Fatty acid degradation
tre00350  Tyrosine metabolism
tre01100  Metabolic pathways
tre01110  Biosynthesis of secondary metabolites
tre01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRIREDRAFT_80920
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TRIREDRAFT_80920
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    TRIREDRAFT_80920
Enzymes [BR:tre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TRIREDRAFT_80920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ThiF
Motif
Other DBs
NCBI-GeneID: 18489252
NCBI-ProteinID: XP_006968225
JGI: Trire2_80920
UniProt: G0RSG5
Position
Unknown
AA seq 353 aa AA seqDB search
MGSIDIPSEQWAQVVEKTGGPVVYKRIPVQKPGPDEVLVNIKYSGVCHTDLHAMMGDWPL
DTKLPLVGGHEGAGVVVARGELVKDIQIGDYAGIKWLNGSCLSCNYCMNGDEPLCHKALL
SGYTVDGTFQEYAIAKAAHVARIPKECDLESVAPILCAGITVYKGLKESLARPGQTIAVV
GAGGGLGSIALQYAKAMGLRSIAIDAGDEKRDLCMRLGASAFVDFSTSKDLVADVRAATV
DGEGPHAALLVAAQEKPFQQATEYLRSKGVLVCIGLPAGARLSAPVFDTVIRMITIKGSY
VGNRADTQEALDFFRRGLITVPFKTIGLSQLQDIYTLMHEAKIAGRYVVDPTR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcatcgatatcccctctgaacagtgggcgcaggtcgtcgaaaagaccggcgga
cccgtcgtctacaagagaatccccgtccagaagcccggccccgatgaggtcctcgtcaac
atcaagtactcgggcgtctgccacaccgatctccacgccatgatgggcgactggccgctc
gacaccaagctgcccctggtcggcggccacgagggcgcgggcgtcgtcgtcgcccgcggc
gagctcgtcaaggacatccagattggcgactacgccggcatcaagtggctcaacgggtcg
tgcctcagctgcaactactgcatgaacggcgacgagcccctgtgccacaaggccctgctg
tcgggctacaccgtcgacggcacgttccaggagtacgccatcgcaaaggcggcgcacgtc
gcccgcatccccaaggagtgcgacctcgagagcgtcgcgcccatcctgtgcgccggcatc
accgtctacaagggcctcaaggagtcgctcgcccgccccggccagaccattgccgtcgtc
ggcgccggcggcggcctcggcagcatcgccctgcagtacgcgaaagccatgggcctgcgc
tccatcgccatcgacgccggcgacgagaagcgcgacctgtgcatgcgcctcggcgcctcc
gcctttgtcgacttctccaccagcaaggacctcgtcgccgacgtccgcgccgccaccgtc
gacggcgagggcccccacgccgccctcctcgtcgccgcccaggagaagcccttccagcag
gcaaccgagtacctgcgctcaaagggcgtcctcgtctgcatcggcctgcccgccggcgcc
aggctcagcgcccccgtcttcgacaccgtcatccgcatgatcaccatcaagggcagctac
gtcggcaaccgcgccgacacccaggaggccctcgacttcttccgccgcggcctcatcacc
gtccccttcaagaccattggcctcagccagctgcaggacatttacacactcatgcacgag
gccaagattgccggccgctacgttgtcgatcctacgagataa

DBGET integrated database retrieval system