KEGG   Trichoderma reesei QM6a: TRIREDRAFT_81049
Entry
TRIREDRAFT_81049  CDS       T02991                                 

Definition
(RefSeq) C-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tre  Trichoderma reesei QM6a
Pathway
tre00100  Steroid biosynthesis
tre01100  Metabolic pathways
tre01110  Biosynthesis of secondary metabolites
Module
tre_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:tre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    TRIREDRAFT_81049
Enzymes [BR:tre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     TRIREDRAFT_81049
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 EptA_B_N
Other DBs
NCBI-GeneID: 18489271
NCBI-ProteinID: XP_006968361
JGI: Trire2_81049
UniProt: G0RST3
Position
Unknown
AA seq 483 aa
MAPTNTKPKYEFGGPLGTAAIVFGLPVLLYFFYFTCNDVTGCPAPALLEPRSLSLAGLKS
QIPWPEDGIWGFASWEASGWLTGYYLLSLVLYRVLPGQELYGTKLRESGRPLKYKLNAFS
STLVQLAACAIGTYLYGSDFAVWTFIDRNYLQLYTANLILSYAISAFVYIRSFSVKPGNS
ELRELAQGGHTGNIMYDFFIGRELNPRITLPLFGEIDLKVWLEMRPGLTGWILLDLAFVA
KQYRNYGYVSDSILFVTAVQTYYVLEGQYAEAGVLGMMDTITDGLGFMLTFGDIVWVPFL
YSTQTRYLSVYPLQLGWTGISIVSAVFAVGVYIFRASNSQKRIFRTQPDHPSVKDMPYIQ
TKRGTRLLAGGWWGASRHINYFGDWLQASPFSLPTGVAGYLILPAGTIASAGAGVATMLD
GREVVQGAARGWGMVYTYFYVVYFASLLIHRERRDDAACAEKYGDDWDKYKKAVRWRILP
GLY
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggccccgacaaacaccaagcccaagtacgagtttggcggcccgctaggcaccgcagct
atcgtctttggcctgcccgtgctgctctacttcttctactttacctgcaacgacgtcacc
ggatgtcctgcgccggccctcctcgagcctcgctcgctctcactggcagggttgaagagt
caaatcccgtggcctgaagatggcatttgggggttcgccagctgggaggccagcggctgg
ttgacgggctactatctgctcagcctggtgctgtatcgagtgcttcctggacaggagctc
tacggcacgaagctgagagaatccggccgaccactcaagtacaagctcaatgcattctct
tctaccctcgttcagctggctgcgtgcgccataggaacgtatctgtacggctctgacttt
gccgtttggaccttcatcgacagaaactacctgcagctatacacggccaatctcatacta
tcgtacgccatctcagcattcgtatacatacgaagcttcagcgtcaaaccaggcaacagc
gaacttagagagctcgcccaaggaggccacacgggcaacatcatgtacgacttcttcatc
ggtcgtgaactgaacccccgcatcacactccccctgttcggcgagattgatctcaaggtc
tggctcgaaatgcgccctggcctgacgggctggatcctgctcgatctcgcctttgtagcc
aagcaatatcggaactacggatacgtgtccgacagcattctctttgtcaccgctgtgcag
acgtactacgtcctcgaaggccaatatgccgaagcgggagtcctgggcatgatggacacc
atcaccgatggcttgggcttcatgctcacctttggcgacatcgtctgggtgcccttcctc
tactccacccagacacgctacctctccgtctaccctcttcaactgggttggacaggaatc
agcatcgtgtcggctgtattcgccgtaggagtctacatattccgcgcctccaactcgcag
aaacgcatcttccgcacacagcccgaccaccccagcgtcaaagacatgccctacatccaa
accaagagaggaactcgtcttctcgccggcggctggtggggagcatcgcgccacatcaat
tactttggcgactggctgcaggcttcaccattcagtcttcctactggcgtggcaggctac
ctgattcttccggctggcacaattgcttctgctggagcaggtgtggcaacgatgctggac
ggccgagaggtggtgcagggtgcggcgaggggatggggcatggtgtatacgtatttctac
gtcgtctactttgcctcgctattgatacatcgtgagaggagggatgacgctgcgtgtgcg
gaaaagtatggtgacgactgggacaagtacaagaaggctgttaggtggaggatcttgcca
ggtctctactag

DBGET integrated database retrieval system