KEGG   Talaromyces rugulosus: TRUGW13939_03742
Entry
TRUGW13939_03742  CDS       T06879                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
trg  Talaromyces rugulosus
Pathway
trg00100  Steroid biosynthesis
trg01100  Metabolic pathways
trg01110  Biosynthesis of secondary metabolites
Module
trg_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:trg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    TRUGW13939_03742
Enzymes [BR:trg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     TRUGW13939_03742
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 55991245
NCBI-ProteinID: XP_035342815
Position
II:complement(join(3689549..3690657,3690718..3691022,3691076..3691176))
AA seq 504 aa
MAKSNTSPKKEAKAKTTVPIQPVPEKRGYEFGGPLGAFGIVFGLPTLLYCFAFFCNDISG
CPAPSLLHPSTLTWPKLKEEIGWPGDGVVGLFDIEVALWVLSYYALLLVLQIFLPGQVVQ
GVPLACGGRHTYKFNTFRSCLLILGGLGVGTYVYGAEFVVWTFLWDNYIQVMTANLVITV
LLSLYVYARSFSIPAPGQQNPQYRELAPGGHTGNILYDFFIGRELNSRVTLPIPFMSEAS
RTIDIGVFCEMRPGLTGWIILNLSNIAQQYRAHGHVTASIILITAIQAFYVLDSYYMEPA
ILTTMDIIMDGFGYMLCFGDLVWVPFLYTTQTRYLATFPAKMDINGIALLSAVSGLGYFI
FRSANNEKNRFRTNPEDPRVKHLEYITTKTGSRLLISGWWGTARHINYLGDWLMSWGFCL
PTGIAGYLMLETLNPATGQIEKQAVQTPEVLGWGSIFTYFYMLYFGVLLIHREGRDEEKC
EKKYGKDWDKYTSLVRYKIIPGIY
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggccaaatcaaatacgagcccaaagaaagaggccaaggctaagacgactgtgcccatc
cagcccgtcccggagaagagaggctatgaattcggtggaccactcggcgcctttggcatt
gttttcggcctccctaccctcctatactgcttcgctttcttttgcaatgacatctcagga
tgcccggccccgtctcttctccacccgtcgaccctgacctggcccaaattgaaggaggaa
attggctggcctggcgacggtgtcgtgggcctttttgatattgaagtcgcactgtgggtt
ctgtcttactatgcgctgctcctcgtgctgcaaatatttctgcctggtcaggtggtgcaa
ggagttccgttggcatgtggtggacgacacacatacaaattcaatacgtttcgctcctgc
ctgttgattttgggcgggctgggtgtaggcacatatgtatatggcgctgaattcgtggtc
tggacattcctctgggataactacattcaagtgatgacagccaatcttgtcattactgtc
ctgctttccctctatgtctatgcaagaagtttctccatcccagctcctggacagcaaaac
ccacaataccgtgagttggcccctggaggccacactggtaacattctctacgatttcttc
atcggtagagaactcaactctcgcgttactttacctatcccgtttatgagcgaggcgtcc
cgaaccattgatattggagtcttttgcgaaatgagaccaggtctgactggatggatcatt
ttgaatttgtcaaacatcgcacaacagtaccgtgctcacggccatgtgacagcctcaatt
attctcataaccgcgattcaagcattctacgttttggatagttactacatggagcccgcc
attttgaccaccatggacatcatcatggacggatttggatacatgctttgctttggcgat
cttgtgtgggtaccgtttttgtacactacccaaacaaggtatcttgccacgttccctgca
aagatggatatcaatggtattgccttattgtctgctgtctcgggacttggttatttcatc
ttccgctcagccaacaacgaaaagaaccggttcagaacaaacccagaggacccacgggtg
aagcacctcgagtatatcaccaccaaaaccggatcccggctgctcatctcgggatggtgg
ggaacagctcgtcatatcaattacctcggggactggctcatgtcctggggcttctgtctt
cctacgggtattgccggttatcttatgcttgagacacttaaccctgccacaggccaaata
gagaaacaggctgtccaaaccccagaggtccttggttggggctcaatattcacatacttt
tatatgctgtactttggggtccttctgattcaccgcgagggaagagatgaggagaagtgc
gaaaagaagtatggcaaagactgggacaagtatacatcgctcgtgcgatataaaatcatc
ccaggtatttactaa

DBGET integrated database retrieval system