KEGG   Thermococcus radiotolerans: A3L10_01065Help
Entry
A3L10_01065       CDS       T05177                                 

Definition
(GenBank) flagellar protein
  KO
K07327  archaeal flagellar protein FlaD
Organism
trl  Thermococcus radiotolerans
Brite
KEGG Orthology (KO) [BR:trl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:trl02044]
    A3L10_01065
   02035 Bacterial motility proteins [BR:trl02035]
    A3L10_01065
Secretion system [BR:trl02044]
 Type II secretion system
  Archaeal flagellar protein
   A3L10_01065
Bacterial motility proteins [BR:trl02035]
 Flagellar system
  Archaeal flagellar proteins
   A3L10_01065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arch_fla_DE DivIVA Mitofilin
Motif
Other DBs
NCBI-ProteinID: ASJ13788
UniProt: A0A2Z2MVB7
Position
183797..184699
Genome map
AA seq 300 aa AA seqDB search
MITETEIEERLKRLRGKVPNFLIDDLKDRLMKKRDILTPEQVDRIVDKVLRTYAGQIEKL
SRLDSRVDEIGRYLEEIRNHLMNLSQAAQANQSLWGEAQNQPMGGAQVVEYGELMGAGNS
GGFGEGSLASETHVEEAPAPESPAQNPTEVEPMEKEFELSKGFEIPSEIRDVLISPPRTK
ARLEHIPNDMVSTMMALKWLGFLIDRVGMQNLEDVLEFYYQIGWISEDVLNTLLRYAEGI
RPHHREPDWRPDEKLTIQDHLVSLLFIERLRGARITRELLDAIEREMRVIGRVLEDVYGV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgattaccgaaaccgagattgaggagaggctcaagcgcctcaggggcaaggtcccgaac
ttccttatcgacgacctcaaagaccgcctcatgaagaagcgcgacatactgactccggag
caggttgacaggatagttgacaaggtgctccgcacctacgccgggcagatcgagaagctc
tcccggctcgacagccgcgtggacgagatcggcaggtacctggaggagatacgcaatcac
ctcatgaacctctcgcaggcggctcaggctaatcagtcactgtggggcgaggcccagaat
caaccaatgggaggggcccaggtcgtggagtacggtgaactcatgggtgctggaaacagc
ggaggtttcggtgaggggtccctcgccagtgaaacccatgtggaggaagcaccggctcct
gagtctcccgcccaaaacccgacggaggtagagcccatggagaaggagtttgagctttcc
aaggggtttgaaatcccctctgaaattagggacgtcctgatcagtcctccacgcaccaag
gcaaggctcgagcacataccgaacgacatggtctcgaccatgatggcgctgaagtggctt
ggcttcctcatagacagggtcggcatgcagaacctcgaggatgtgcttgagttctactac
cagatcggctggatttctgaggacgtgctgaatactttgctcaggtacgctgagggcata
aggcctcaccaccgggagcccgactggaggccggacgagaagctcacgatacaggatcac
ctcgtttcgctgctcttcatagagcgccttaggggagccaggataaccagggaactgctg
gacgccatagagagggaaatgcgggtgatcggcagggtgctggaagacgtgtacggagtt
tag

DBGET integrated database retrieval system