KEGG   Thermococcus radiotolerans: A3L10_02765Help
Entry
A3L10_02765       CDS       T05177                                 

Definition
(GenBank) sodium:phosphate symporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
trl  Thermococcus radiotolerans
Brite
KEGG Orthology (KO) [BR:trl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A3L10_02765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ASJ14106
UniProt: A0A2Z2N8Q5
Position
complement(509841..510749)
Genome map
AA seq 302 aa AA seqDB search
MITALFMAWAIGANDSAKAVGTAVGSGVLGFKRAVLIIGIFTTLGVFLGGSGVSGTVSGL
AEGMSAGEVGLVLFSAASAVTLASLWGRPISTTQSIIGGLVGASLALGLPVDWWTVGRIA
SAWVLSPIVAALFAVAVYRLYKPLLRRIKCLRNLELTQKWLVFTAAAFSAFNLGANELSN
VAGVMEGLGIDGPFKLLLALTLTLGALTFSYDVMMTVGRDISPLGPTSAFSSQFGASLAV
SAANLIGLPVSSGQAIVGAISGLGLYKGERVNLKLLVGIVKGWVIAPVFAGAISYVLITF
LA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgataacggcgctcttcatggcgtgggcgataggcgcaaacgacagcgcaaaggccgtc
ggaacggccgttggctcaggcgtactcggcttcaagagagccgtgctcatcatagggata
ttcaccactctaggggtcttccttggaggttccggcgtttccggaacggtctccgggctc
gccgagggcatgtccgcgggcgaggtcggactcgtccttttcagcgccgcctctgcagta
accctcgcgagcctctggggaaggccgatctcaacgacccagtccataataggcggtctc
gtcggagcttccctcgccctcggactgccagttgactggtggacggttggcagaatagca
tcggcgtgggttctctcaccgatcgtcgccgctctcttcgcggtggcggtctacaggctc
tacaagcctctgctgagaaggataaagtgtctgcggaacctcgagctgacccagaagtgg
ctcgtcttcaccgcggcggcattttcggccttcaacctcggcgccaacgagctttcgaac
gtggccggagtgatggaaggcctcggaatagacggtccgtttaagctcctcctggcgctt
accctaaccctgggagcgctgaccttcagttacgacgtgatgatgacggttggaagggac
atctcgcccctcgggccaacctcggccttttcaagccagttcggggcatctctggccgtc
agcgcggccaacctgataggcctgcccgtcagctcgggtcaggccatagttggggccata
agcggtctgggcctctacaagggcgagcgcgtgaacctcaaactcctcgtgggaatcgtg
aagggctgggtaatcgcgccggttttcgcgggtgcgatatcctacgttctcataacgttc
ttagcttag

DBGET integrated database retrieval system