KEGG   Thermococcus radiotolerans: A3L10_09750Help
Entry
A3L10_09750       CDS       T05177                                 

Definition
(GenBank) hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
trl  Thermococcus radiotolerans
Brite
KEGG Orthology (KO) [BR:trl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:trl03016]
    A3L10_09750
Enzymes [BR:trl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     A3L10_09750
Transfer RNA biogenesis [BR:trl03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    A3L10_09750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-ProteinID: ASJ15395
UniProt: A0A2Z2N011
Position
complement(1781076..1781684)
Genome map
AA seq 202 aa AA seqDB search
MFLYTKNFDEQKARAMEGLRRALAEGKVDDDIIPLLDKINSLENYFTTSSCSGRISVMEM
PHFGDKVNSVWLGKWHRTVKVEEVLEAIGRHEKGQLWFLIRSPILHVGARTMEDAVKLLN
LAIGLGFKYSNIKSVSHKKLLVEIRSTERMDVPLGTDGELWVDEAYIERIVGIANSQVRR
FKGKLKRLGEEVEKIENAHQSP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgttcctctacaccaagaacttcgatgagcagaaggcgagggcgatggaaggcctcagg
cgggccttagccgagggcaaggtggatgatgacataatcccactgctcgataaaataaac
tcccttgagaactacttcaccacctcctcgtgctcgggcaggatttcggtcatggagatg
ccccacttcggagacaaggtgaactcggtctggctcggcaagtggcacagaaccgtcaaa
gtcgaggaagtccttgaggctatcgggagacacgaaaagggccagctctggttcctgatc
aggagcccgattcttcacgtcggggcgagaaccatggaggacgctgtaaaactgctcaac
ctcgccatcggcctgggcttcaagtactcgaacatcaagagcgtgagccacaagaagctc
ctcgttgagatacgctccaccgagaggatggacgttccgctcggtaccgatggggagctc
tgggtcgatgaggcctacatcgagagaatagttggaattgccaactcccaggtaaggcgc
ttcaaggggaagctcaagaggctgggggaagaggttgaaaagatagagaacgcccaccag
tcaccttaa

DBGET integrated database retrieval system