KEGG   Treponema sp. OMZ 838: JO41_02620Help
Entry
JO41_02620        CDS       T03454                                 

Definition
(GenBank) propionate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
trm  Treponema sp. OMZ 838
Pathway
trm00430  Taurine and hypotaurine metabolism
trm00620  Pyruvate metabolism
trm00640  Propanoate metabolism
trm00680  Methane metabolism
trm01100  Metabolic pathways
trm01120  Microbial metabolism in diverse environments
trm01200  Carbon metabolism
Module
trm_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:trm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JO41_02620
   00640 Propanoate metabolism
    JO41_02620
  09102 Energy metabolism
   00680 Methane metabolism
    JO41_02620
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    JO41_02620
Enzymes [BR:trm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     JO41_02620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AIW88828
UniProt: A0A0A0WX89
Position
570133..571482
Genome map
AA seq 449 aa AA seqDB search
MVILTLNCGSSSVKYQVYDWDNKSVLASGVVERVTQPGSVITHEAKGKDKYVLESPCPTH
THAVELIIKTLTDSSVGVITDMNVIKAVGHRVTHGGDKFIKSVIVTPEIINTFREVQDLG
PLHNPANIMGIEAAQKVLPNVPHCAVIDTAWHQTMPETSFMYAIPHEWYEKYSARRYGFH
GTSFLYTAKRAAVILGKKPEDTNIVIAHIGNGASMCCVKQGKCFDTSMGLTPLEGLVMGT
RSGDCDPALPFYIMRKTGMTPAEMDTALNKKSGLFGVTGQYVDRRDVSKAMEEGDKRARL
AFNMEVYRLQKYFGAYIAALGQKPDAIVFTAGVGEFGFDTRLAVCEGLTHLGIKIDPKKN
ALARTRNAETCISADDSPVKIFVIPTDEELVMTEDAYALMKGTYDVHTKFTYSFQSPDYV
NKARAEGLKKDLEKKPELANIVVKIPGAR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggttattttgacattgaactgcggcagttcttcggtaaagtatcaggtgtatgattgg
gacaacaaaagtgtccttgcatcgggtgttgtagaacgggtaactcagcccggcagcgtt
attacccacgaggcaaagggaaaagacaagtatgtgctggaaagcccctgtcccacccat
acccatgcggttgaactcattatcaagaccctaacggattcgtccgtaggtgttatcacc
gacatgaatgtgattaaggctgtcggccaccgcgtaacccacggcggagataaatttatc
aagtcggttatcgtaacccccgaaatcatcaacacattccgcgaagtgcaggatttagga
ccgctgcacaatcccgccaatattatgggtatcgaagctgctcagaaagtactgccgaat
gttccgcactgtgcggttatcgacacggcgtggcatcagacgatgcccgaaacaagcttt
atgtacgccattccccacgaatggtacgaaaaatattccgcccgccgttacggcttccac
ggcaccagctttctctacacggcaaagcgagctgccgtcatcctcgggaaaaagccggag
gataccaatatcgtcatcgcgcatatcgggaacggcgcttcgatgtgctgcgtcaagcag
ggcaagtgcttcgatacctcgatgggactgaccccattggaaggcttggtcatgggtacc
cgatccggcgactgcgatcccgcccttcccttctatattatgcggaaaaccggcatgaca
ccggcggaaatggatactgccttgaacaaaaaatcaggacttttcggcgttaccggacaa
tatgttgaccgccgcgatgtttctaaggcgatggaagaaggcgataaacgggcacggctt
gcctttaatatggaagtatatcgcttgcaaaaatacttcggcgcctatatcgccgcgctt
ggtcaaaaaccggatgcaattgtcttcaccgccggcgttggagaattcggcttcgacacc
cggctcgccgtctgcgaaggcttaactcacctcggtatcaagattgaccccaagaagaat
gcacttgcccgtacccgcaacgcggaaacctgcatcagcgctgatgactcgccggtaaag
atattcgttatccccaccgacgaagaactcgttatgacggaagacgcatatgcattgatg
aagggaacctacgacgtgcataccaagttcacctattcattccagtcgcccgactatgtc
aacaaagctcgcgcggaaggcctaaaaaaagacctcgaaaagaaaccggaacttgcaaac
atcgtcgtaaagattcccggcgcacggtaa

DBGET integrated database retrieval system