KEGG   Treponema sp. OMZ 838: JO41_07585
Entry
JO41_07585        CDS       T03454                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
trm  Treponema sp. OMZ 838
Pathway
trm00230  Purine metabolism
trm01100  Metabolic pathways
trm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:trm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    JO41_07585
Enzymes [BR:trm01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     JO41_07585
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AIW89665
UniProt: A0A0A0X2V1
Position
1605098..1607395
AA seq 765 aa
MIVGKAVPRVDAYDKVTGRAKYVDDYFHSDFLVAKVLHSTIANGLVKKIDTSAAEKIPGV
VKIVTCFDVPDICFPTAGHPWSTEAAHQDIADRRLLNTRVRFYGDDIAAVIAEDNVAAER
ALKAITVEYEEYPPIMDVHQAMSPEATVLHEAFPGNVLKHTVFSVGQYEETPDDPDTVMF
EGDYAVSPISHCHIENPGSYAYMKGGKIIVVSSTQLPHICRRVCGQALGIDWGKIRVIKP
YIGGGFGNKQDILYEPLNAYLCTLVGGRCVQLSVSREETFMCTRTRHAMEFHMKTTVRKS
DGRFISRKMLCYSTKGGYASHGHAITANASNEFKQLYSAEKGIISEAYSVFTNHITAGAM
RAYGIPQADFALESFMDDMALKLNMDPIDLRLKNCMREGYEDPVTKIRANSDGLYQCLQK
GREVFHWDELRKKYANQTGPVRRGVGVACFNYKTGVYPISLETASARIMLNQDGSIQIQM
GATEIGQGADTVFCQMAAEVLSLPMDKVYIFSEQDTDVSPYDSAAYASRQTYVSGKAIKK
TAESLKRKILEYAAWMLDMKADELDLQHEKIIVRSTGEERLTLEEVAMESCYSMKESNHL
SAEETSHCTDNCFSFGATFVEIEVDIPVGKITVLNILNLHDSGTLINPQLAAAQVHGGMG
MGIGAATAEQMLYDNKGKLLNGNLLDYKMPTAMDLPDLHELFIENADPTGPFGNKSLGEP
PIISQPPAIRNALLHATGVAINKLPLNPQRLFEAFSESGLLKEVI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgatagttggaaaagcggtgccccgtgtcgatgcttacgataaggtaaccggcagggca
aagtatgttgacgattattttcacagtgattttttagtcgcaaaggtattgcacagtacc
atcgcgaacggactggtaaaaaaaatcgatacaagcgctgcggaaaaaatccccggcgtg
gttaagattgttacctgtttcgatgtgccggacatttgttttccgactgcgggacacccg
tggtctaccgaagcggcgcatcaggatattgccgaccggagactgctgaacacgagagta
cgcttctacggggatgatattgcggcagtcattgcagaagacaatgtcgctgcagagcgt
gccttaaaagcaatcaccgttgagtatgaagaatatcctcctattatggatgtgcatcaa
gcgatgtcccctgaagcgaccgtattacacgaagcattcccgggcaatgtgctgaagcat
acggtgtttagcgtaggccagtatgaagaaacgccggatgatcccgatacggtcatgttt
gaaggtgattatgcggtatctccgatttctcactgtcatatagaaaatcccggctcgtat
gcgtatatgaaaggcggaaagattatcgtggtgtcttccacgcagctgcctcatatctgt
cgccgcgtgtgcggacaggcgctcggaatcgactgggggaaaatacgggttatcaagccg
tatatcggcggcggcttcggcaataagcaggacatcctgtatgaaccgctgaacgcttac
ctttgtacgctcgtaggcggccgctgtgtgcagctgtccgtttcgcgtgaggaaaccttt
atgtgtacccgcacgcgccatgcgatggaattccacatgaagacaacagtgcggaagtcg
gacggcaggttcatttcgcgcaaaatgctctgctattctacgaagggcggttacgcttca
cacggacacgctattaccgcgaatgcctccaacgagtttaagcagctctattcggcggaa
aagggaatcatttccgaagcgtattccgtgtttaccaatcatattaccgcaggggctatg
cgcgcgtatgggattccgcaagcggattttgcccttgaatcttttatggatgatatggcg
ctcaaactgaatatggatcctatcgatttgcggctcaagaactgtatgcgggaagggtat
gaagatcctgttacaaagattagagcaaactcggacgggctctatcaatgcttgcagaaa
ggccgcgaggtgttccactgggatgagctgcggaaaaagtatgcgaatcagacagggccg
gtgcgccgcggtgtcggagttgcctgctttaactacaaaaccggcgtttaccccatctcg
ctcgaaaccgcctccgcccgtatcatgctcaatcaggacggcagtattcaaattcagatg
ggggcgacggaaataggacagggcgccgatacggtgttctgccagatggctgccgaagtg
ctttcgctgccgatggataaggtctatattttttccgaacaggataccgatgttagcccg
tacgacagcgcggcctatgcttctcgtcaaacatacgtgagcggcaaggcgattaaaaaa
actgccgaatcgcttaaacgaaagatattggaatatgcggcgtggatgctcgatatgaag
gccgatgaacttgatctgcagcatgaaaaaattattgtccgtagtaccggcgaagagcgg
ctcaccttggaagaggtcgcaatggaaagctgttacagtatgaaagaatccaatcacctc
agcgcggaagaaacgtcgcattgtaccgataactgcttctcgttcggtgcaacctttgtt
gagattgaggttgatattccggtcggcaaaatcacggtattgaatattttgaacctgcac
gacagtggtacgcttatcaatccgcagctggcggcggctcaggtacacggcggcatggga
atgggaatcggtgctgcaactgccgaacagatgctttatgataataaaggcaagctgctg
aacgggaatcttttggattataagatgccgacggcgatggatcttcccgacttacacgag
ctgtttatcgaaaatgccgatcccaccggccccttcggaaataaatcactgggcgagccg
ccgattatttcgcagccgccggcaatccgcaatgcgctgctccatgccaccggcgttgcc
attaacaagctgccgcttaatcctcagcggctttttgaagcgttcagcgagagcgggctg
ctgaaggaggtaatctaa

DBGET integrated database retrieval system