KEGG   Thermomicrobium roseum: trd_0495Help
Entry
trd_0495          CDS       T00845                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tro  Thermomicrobium roseum
Pathway
tro00620  Pyruvate metabolism
tro00630  Glyoxylate and dicarboxylate metabolism
tro01100  Metabolic pathways
tro01110  Biosynthesis of secondary metabolites
tro01120  Microbial metabolism in diverse environments
tro01200  Carbon metabolism
Module
tro_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    trd_0495 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    trd_0495 (aceB)
Enzymes [BR:tro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     trd_0495 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACM05463
UniProt: B9KYF0
Position
complement(490918..492486)
Genome map
AA seq 522 aa AA seqDB search
MGDVRIVGRMTPEFAQILTEPALDFVASLHREFNLRRKQLLERRAERQQAIDAGHFPDFL
PETAHIRESEWRVAPTPPDLEDRRVEITGPVDRKMMINALNSGARVFMADFEDALSPTWD
NVVQGQINLRDAVRRTISFESPDGRVYRLADKTATLVVRPRGWHLVERHVLVDGEPISAS
LFDFGLYFFHNAHELLARNTGPYFYLPKLESHLEARLWNDVFNFAQDRLGIPRGTIRATV
LIETILAAFEMDEILWELRDHAAGLNAGRWDYIFSVIKKFRRHREFLLPDRAQVTMTVPF
MRAYTELLVRTCHRRGAHAIGGMAAFIPSRRDPQVNEIALAKVREDKEREAKDGFDGTWV
AHPDLVPVALEVFDRVLGEQPHQKHRLREDVQVTARDLLDVRVPGGRITEGGLRNNVSVA
LQYLDSWLRGQGAAAIFNLMEDTATAEISRAQLWQWRFHRAELDDGRPVTAELYVQIRDE
ELTKLGGEVAGRLREAREILDRLVLDDEFTEFLTYLAYEYID
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgtgcggatcgtgggacgcatgactccggagttcgcccagatcctcaccgaa
ccagccctcgacttcgtcgcgagcctccatcgagagttcaaccttcgccgcaagcagctg
ctcgaacgacgagccgaacgccaacaggcgatcgatgccggccattttcctgattttctt
cccgaaactgctcacattcgtgaaagcgagtggcgtgtcgcgccgactccccctgatctc
gaggatcggcgcgtcgagattaccgggcctgtcgatcgcaaaatgatgatcaacgccctc
aactccggtgcgcgcgtcttcatggcggacttcgaggatgcgctctcgccgacttgggat
aatgtggtgcaaggccagatcaatctccgcgatgccgtccggcgaaccatcagcttcgaa
agcccggacggcagggtctatcgtctcgccgacaagaccgcgacactcgtcgtccgacca
cgcggctggcatctcgtcgaacggcatgtcctggtcgatggagaaccgatctcggcgagt
ctcttcgacttcggtctctactttttccacaacgcgcacgagttgctagccaggaacacc
gggccctacttctacttgcccaaactggagagtcacctggaagcgcgcctctggaacgac
gtcttcaacttcgcccaggatcgcctcggcattccgcggggaacgattcgggcgaccgtc
ctcatcgagacgatcctggctgccttcgagatggacgaaattctctgggaactgcgtgat
catgctgctggactcaatgctgggcgatgggattacatctttagtgtcatcaagaagttc
cgccggcaccgggagttcctcctgcccgatcgggcacaggtcacaatgaccgtgccgttc
atgcgtgcgtacaccgaactcttggtgcggacgtgtcaccgccgtggagcacacgccatc
ggcggaatggctgccttcatccccagccggcgcgatccgcaagtcaacgagatcgccttg
gcgaaggttcgcgaggacaaggaacgggaagccaaggacggcttcgacgggacgtgggtc
gcgcaccctgacctcgtccccgtcgcgctcgaagttttcgatcgcgtcctgggcgagcaa
ccccaccagaagcatcgcctccgcgaggacgtgcaggtgacagcacgcgacttgctggac
gtgcgcgtgccaggaggacggatcaccgagggaggactccggaacaacgtcagtgtcgcg
ctgcagtacctggacagctggctgcgtggccaaggcgccgcggccatcttcaacctgatg
gaggatacggcgactgccgagatctcgcgcgcgcagctctggcagtggcgcttccatcgc
gccgaactcgacgatggtcggccagtcacggccgagttgtacgtccagatccgcgacgag
gaactcaccaagctcggcggagaggtagccggtcggcttcgagaggcgcgcgagatcctc
gatcgtctggtgctcgacgacgagttcaccgagtttctcacctacctggcgtacgagtac
atcgactga

DBGET integrated database retrieval system