KEGG   Thermomicrobium roseum: trd_0539Help
Entry
trd_0539          CDS       T00845                                 

Definition
(GenBank) TENA/THI-4 family
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
tro  Thermomicrobium roseum
Pathway
tro00730  Thiamine metabolism
tro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    trd_0539
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tro03000]
    trd_0539
Enzymes [BR:tro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     trd_0539
Transcription factors [BR:tro03000]
 Prokaryotic type
  Other transcription factors
   Others
    trd_0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: ACM06178
UniProt: B9KYJ3
Position
complement(533457..534122)
Genome map
AA seq 221 aa AA seqDB search
MTSFTQELWRSIDPIYQAIVVHPFLVGLTDGTLPEEAFRFYVVQDALYLQDYARCLALAA
AKAPRETWCELFADHAKVALVVERALHESFFAAWGLSPDKIAGTPYAPTNLAYTSYLLRV
AYERPFEEVIGALLPCYWIYWEVGKHLERSGSPNPLYQKWIDTYASEEYAAVVQAVLDVA
DQVVTDLPESRRQPIRTHFVTTARYEWMFWDAAWRLERWPV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcttcacccaagagctctggcgctcgatcgatccgatctaccaggcgatcgtc
gttcaccccttcctcgtcggcctgaccgacggcaccttacccgaagaagcatttcgcttt
tacgtcgtgcaggacgcactttacctgcaggactatgcccgctgtctcgcgctggctgct
gccaaggcaccgcgcgagacgtggtgcgagctctttgccgaccacgccaaagtagcgctg
gtcgtggagcgtgccttgcacgagagtttcttcgctgcctggggactttctcccgacaag
atcgctggcacgccgtacgcgccgacgaacctcgcgtacacctcctatcttttgcgggtc
gcctacgagcgtccgttcgaggaggtcatcggtgcactgcttccctgctattggatctac
tgggaagtgggcaagcacctggaacgatctggttcaccgaacccactgtatcagaagtgg
atcgacacttatgcgtcggaagagtacgcagctgtcgtccaggcggtactggatgtcgct
gaccaggtggtgaccgacctccccgagtcgcgccggcaacccattcggacacacttcgtt
acgaccgcccgctacgagtggatgttctgggacgctgcctggcgcttggagcgctggcca
gtgtga

DBGET integrated database retrieval system