KEGG   Thermomicrobium roseum: trd_0582Help
Entry
trd_0582          CDS       T00845                                 

Definition
(GenBank) NAD-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tro  Thermomicrobium roseum
Pathway
tro00010  Glycolysis / Gluconeogenesis
tro00071  Fatty acid degradation
tro00350  Tyrosine metabolism
tro00625  Chloroalkane and chloroalkene degradation
tro00626  Naphthalene degradation
tro01100  Metabolic pathways
tro01110  Biosynthesis of secondary metabolites
tro01120  Microbial metabolism in diverse environments
tro01130  Biosynthesis of antibiotics
tro01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    trd_0582
  Lipid metabolism
   00071 Fatty acid degradation
    trd_0582
  Amino acid metabolism
   00350 Tyrosine metabolism
    trd_0582
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    trd_0582
   00626 Naphthalene degradation
    trd_0582
Enzymes [BR:tro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     trd_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACM05307
UniProt: B9KYN5
Position
580312..581298
Genome map
AA seq 328 aa AA seqDB search
MRAMVLERPGQPLVLQELPVPEPGPGQVLLRIRACGVCRTDLHIVAGELPGPKLPLVLGH
QIVGEVVRAGPGANRLVPGQRVGVPWLGWTCGECRYCRSGRENLCDRARFTGYTLDGGFA
EYTVADERYCFPIPAGYPDEQAAPLLCAGLIGYRALRFAGEAQRLGFYGFGAAAHILTQV
AVWQGRTVYAFTRPGDLESQVFARELGAVWAGGSDESPPEQLEAALIFAPVGALVPQALR
AVEKGGIVVCAGIHMSDIPSFPYAWLWEERVIRSVANLTRQDGEAFLSLAPRVPVRTEVQ
LYRLEEANRALDDLRHGRIRGAAVLVID
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgatggtgctcgaacgaccggggcaacccttggttctccaggagcttcccgtc
ccggagccgggtccgggccaggtcttgctccggatccgtgcctgtggtgtctgccggacc
gacctccacatcgtcgctggggagttgccgggtccgaagttgccgctcgtcctcgggcat
caaatcgtcggagaggttgtccgggccgggccgggggcgaatcgactcgttcccggtcag
cgtgtcggcgtgccctggctcggctggacgtgcggagagtgtcgctattgccgaagcggg
cgcgagaacctctgtgatcgtgcccgcttcactgggtacacgctggatggcggcttcgct
gagtacacagtcgctgacgagcgctattgctttccgattccagcgggttacccggacgag
caggcagcaccgctcctctgtgccgggttgatcggctatcgtgcgcttcgttttgctgga
gaggcccaacgattgggtttttatggcttcggtgctgcggcacatattctcacgcaagtg
gccgtgtggcaggggcggaccgtttatgccttcacccggcctggtgatctggagagtcag
gtcttcgcgcgagagctcggagctgtctgggcagggggctcggacgaatcgccgccggaa
caactggaggcagcgctcatcttcgcgccggtgggggcgctcgtcccacaggcgctccgc
gcggtggagaaaggcggcatcgtcgtctgcgctggtatccacatgagcgatattccgtcg
tttccatatgcctggttgtgggaagaacgcgtgattcgttccgttgccaacttgacccga
caggatggcgaagcgttcttgtcgctcgccccaagagtgccggtgcggacagaggtccag
ctgtaccggttggaagaggcgaaccgggcgctggacgatctgcggcacgggcgcatccgc
ggtgcagccgtcttagtgatcgactag

DBGET integrated database retrieval system