KEGG   Thermomicrobium roseum: trd_1421Help
Entry
trd_1421          CDS       T00845                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
tro  Thermomicrobium roseum
Pathway
tro00860  Porphyrin and chlorophyll metabolism
tro01100  Metabolic pathways
tro01110  Biosynthesis of secondary metabolites
tro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    trd_1421
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tro01007]
    trd_1421
Enzymes [BR:tro01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     trd_1421
Amino acid related enzymes [BR:tro01007]
 Aminotransferase (transaminase)
  Class III
   trd_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACM05425
UniProt: B9L2L9
Position
1415800..1417218
Genome map
AA seq 472 aa AA seqDB search
MSTDRLLGDAYFAQSRQLFERISRTIAGGESSYARLKKGLELCFDHGEGSHFWDIDGHEY
IDYSLGYGPLIFGHKPKRVIQAVIEAIERYGTISTFPYELDAEVGELFTELVPGVDLLRF
ANSGTEATMAAARLARAYTGRPKIVQMEGAYHGWADTHLWSSHPDVWRPQLRPYSPRPIP
GSRGIPEVYGEALLIAQYNDRESLERLFAEHGNEIAAVLVEPVQCNSGVILPEPGYLEFL
REITRSYGALLIFDEVITGFRLAPGGAQERLGVIPDIATYAKALGAGFPIAAFGGSREVM
QLEATNQVMHGGTYTANVVALAAARAVLTEMKTRRDELWAVLNGFGERVREGLREACEAA
GLRCIVQGIGPVWHIFFAKPDAPALDRIRNYREAHAYTSIDIYDRFNRAMLRRGVYFHPY
HLERWFISTAHSESDVQATLQAAHEAALEVAQSLREQPAADPASLAMPGIAQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgatcgtttgctgggcgatgcgtatttcgcccagagccggcagcttttcgag
cggatcagtcgaacgatcgcaggtggcgagagttcctacgcacggttgaagaagggtttg
gaactctgcttcgatcacggtgagggctcccacttctgggacatcgatggtcacgagtac
atcgactacagcctcggctatggtcccctgatcttcggtcacaagccgaagcgagtgatc
caggcggtcatcgaggcgatcgagcgctatggaacgatctccacgttcccgtacgaactc
gatgccgaagtcggcgagctgttcacagaacttgtcccaggagtcgatctcctgcggttc
gccaactccggtaccgaggcgaccatggcggccgcacgtctggcgcgggcctataccggg
cgacccaagatcgtccagatggagggtgcctatcacgggtgggccgatacccacctgtgg
tccagccatcccgacgtctggcgtccacagctgcggccctacagcccgcggccgatcccc
ggctcgcgcgggatcccggaggtctacggggaagcgctgctgatcgcccagtacaacgac
cgcgagagcctcgaacggctcttcgccgagcatggaaacgagatcgctgctgttctcgtc
gagccagtgcagtgcaactcgggtgtcatcctgccggagcctggctacctcgagttcctg
cgcgagatcacccgctcctacggcgcgctgctcatcttcgacgaagtgatcaccggtttc
cggctcgctcccggtggcgcgcaagagcgcctgggcgtgatccccgatatcgcgacgtac
gccaaggcactcggtgctggtttcccgatcgccgcgttcggcggctctcgcgaggtcatg
caactcgaggcgaccaatcaagtcatgcacggcggtacgtacacagcgaacgtcgtcgcg
ctcgcggccgcacgcgccgtgctgaccgagatgaagacgcgccgcgacgaactctgggcc
gtcctcaacgggttcggtgagcgcgttcgcgagggattgcgcgaggcctgtgaagcagcc
gggctgcgctgcatcgtgcaggggatcggaccggtctggcacatcttcttcgccaagccg
gacgctcccgcgctcgatcggatccgcaactatcgcgaggcgcatgcgtacaccagtatc
gacatctacgatcgcttcaaccgggcgatgctccggcgcggcgtctacttccacccctat
cacctggagcggtggttcatttcgaccgcacacagcgagagcgacgtgcaggcgacgctc
caagctgcccacgaagccgcgctggaagtcgcacagtcgctgcgggagcagccggctgcc
gaccccgcgagcttggcgatgcccggcatcgcccagtga

DBGET integrated database retrieval system