KEGG   Thermomicrobium roseum: trd_1683Help
Entry
trd_1683          CDS       T00845                                 

Definition
(GenBank) pyruvate carboxylase subunit B
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tro  Thermomicrobium roseum
Pathway
tro00620  Pyruvate metabolism
tro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    trd_1683
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tro02000]
    trd_1683
Enzymes [BR:tro01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     trd_1683
Transporters [BR:tro02000]
 Other transporters
  Primary active transporters [TC:3]
   trd_1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: ACM06087
UniProt: B9L0X3
Position
1684776..1686266
Genome map
AA seq 496 aa AA seqDB search
MAPRIQLIDVTLRDGNQSLWSAIGVDTRTVAEVAPWIDRAGFASIDFTTSTHMAISVRYH
REDPFEKIRLARLLMPNTPLIFMTTGMRFITWEPAPRAIMRLALRVVVRHGIRRVQIVEP
MNNMSALLEAARIAREEGAEQVVAGLVYSISPVHTDEFYLRCAEDLARERQLLDRVYIKD
PSGLLTPERVQTIVPALRRALGPDVPLEMHSHCTMGMAPLCYLRAVELGVQTVHTAIPPL
AEGTSLPSVYRTVANLRELGFEAEIDLQPLTHVTAYLERLARRKGYPVGQPLEYDVSFYR
HQVPRGMITTLRRHLKEAGAEHPFEKVLEEIVRVRAELGYPIMVTPYSQLVATQALLNLE
AQERYEKVPDEVIKYVLGRYGPPPAPIDPWVQERVLSLPRARELDVPVPEPTLEELRRAF
GSSISDEELLLRWALPSDQVDAALARKTGNVALSGNRYRHPLAQLIAHVAQQPSISYFHL
ERNGVRLTLGRHSTSQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtggctccgcgtatccagctcatcgacgtcacgctccgtgacggcaatcagagcctgtgg
agcgcgatcggagtcgatacgcgcacggtagcagaggtcgctccgtggatcgaccgtgct
gggtttgcatcgatcgactttacgacgagcacccatatggcgatcagcgtccgctaccat
cgtgaggatccgttcgagaagatccggctcgctcgactgttgatgcccaacacaccgctc
atcttcatgacgaccggcatgcggttcatcacttgggaacctgcaccgcgcgccatcatg
cggctcgctttgcgcgtcgtcgtccggcatggtatccgccgtgtccagatcgtggagccg
atgaacaatatgagcgcgctgctggaggctgctcgcatcgctcgcgaagaaggagccgag
caggtcgttgccgggctcgtctacagcatcagcccagtccatactgacgagttttatctc
cggtgtgcggaggatctcgcccgcgagcgccaactcctcgatcgggtctatatcaaggat
ccgtccggattgctcacaccagagcgtgtccagacgatcgtgccagcgctccgacgagca
ctcgggccagatgtaccgctcgaaatgcattcccattgcacgatgggcatggcaccgctc
tgttacttgcgtgctgtcgaactcggtgtccagaccgttcacaccgctattccgccgctc
gccgagggaacatcgttgccttccgtctatcggacggtcgcgaacttgcgggaactcggc
ttcgaggcggaaatcgatctgcaaccgctcacccacgtgacggcgtatctcgagaggctg
gcacgtcgcaaggggtatcctgttgggcagccgctggagtacgatgtgtccttttaccgc
caccaagtgccgcgaggaatgatcacgaccctgcgccggcatttgaaggaagcgggagca
gagcatccgttcgagaaggtgctcgaagagatcgtccgtgtccgtgctgaattgggctat
cccatcatggtcaccccctactcgcaactcgtcgcgacacaagcgctcctcaatctggaa
gcgcaggagcgctatgagaaggtgcctgacgaggtgatcaagtacgtgctcgggcgctac
ggtccaccaccagcaccgatcgatccctgggtacaggaacgggtactctcgctgccgcga
gcacgtgagctcgatgttccagttcccgaaccgactctcgaggaacttcggcgggcgttc
ggttcctccatctcggacgaggagctgctcttgcgctgggcacttccgagcgatcaggtc
gatgctgcattggctcgcaaaactgggaatgtggccctgtccggtaacaggtaccggcac
ccgctcgcccagctgatcgcccatgtcgcacagcaaccatctatcagttacttccatctc
gaacgaaatggcgtccgcctcacgctcggtcgtcattcgacttcccagtaa

DBGET integrated database retrieval system