KEGG   Thermomicrobium roseum: trd_1726Help
Entry
trd_1726          CDS       T00845                                 

Definition
(GenBank) putative PHP domain
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
tro  Thermomicrobium roseum
Brite
KEGG Orthology (KO) [BR:tro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    trd_1726
Enzymes [BR:tro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     trd_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP SPOR
Motif
Other DBs
NCBI-ProteinID: ACM04580
UniProt: B9L115
Position
complement(1730801..1731658)
Genome map
AA seq 285 aa AA seqDB search
MGTIDLHTHTTASDGILSPEELVELAAVRGIEVLGITDHDTVAGLPAAQSAAAHRSVKIV
PGIELSTAVETGEVHILGYFIDPADPVLQAHLASLATARRERAQRMVDRLRQLGIPVTME
DLEAIAQGGTITRAHAARLLVARGFAGSIDEAFERFLGRNRPAYVPRTYPSPRRAVEIVL
AAGGAPVLAHPLSAGDPETILGELVPVGLVGLEAWYAEYAPEIQRELVALAARWGLIPTG
GSDYHGPGFRAERELGSVDVPRQSVDMLAARARSGRGGAATLPEQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgggtacgatcgaccttcacacgcacacgacagcgtcggatggcatcctctcgcccgag
gagctcgtcgagcttgccgcggtgcgcggtatcgaggtgctcgggatcaccgaccacgat
acggtcgctggtcttccggctgcccaatctgcggctgctcatcggagtgtgaagatcgtc
ccgggcatcgagctgagcacagcggtcgaaacaggcgaagtccatatcctcggttatttc
atcgatccagcggacccggtgcttcaggcacatctggcgtcgctcgccactgcgcgccgg
gagcgcgctcagcggatggtcgatcgactccgacagctcggtattcccgtgacgatggag
gatctcgaagcgatcgcccaagggggaaccatcacccgcgctcacgcagcgcgcttgctc
gtcgcgcgagggttcgcgggatcgatcgacgaggcgttcgagcggttcctgggacgcaac
cgcccggcgtatgtgccacggacgtatccctcgcctcggcgtgccgtcgagatcgtgctg
gctgccgggggcgctccggtgctcgctcatccgctgagtgccggtgatccggagacgatt
ttgggggaactcgtgccggtcgggctcgttgggttggaagcctggtatgccgagtatgcg
ccggaaatccaacgtgaactcgttgcgctggctgcgcgctggggattgatcccgactggt
ggaagcgattaccacggacctgggttccgagccgagcgcgaactcgggagtgtcgatgta
ccccgccagtcagtggacatgctggcagcacgggctcgctcgggtcgaggaggtgctgct
acactgcctgagcagtga

DBGET integrated database retrieval system