KEGG   Thermomicrobium roseum: trd_A0200Help
Entry
trd_A0200         CDS       T00845                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tro  Thermomicrobium roseum
Pathway
tro00260  Glycine, serine and threonine metabolism
tro00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tro01100  Metabolic pathways
tro01110  Biosynthesis of secondary metabolites
tro01130  Biosynthesis of antibiotics
tro01230  Biosynthesis of amino acids
Module
tro_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    trd_A0200
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    trd_A0200
Enzymes [BR:tro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     trd_A0200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACM07120
UniProt: B9L336
Position
unnamed:complement(181915..183282)
Genome map
AA seq 455 aa AA seqDB search
MSAAETVKFVLTEADLPTHWYNLAADLPTLPPPPIHPGTGEPVGPADLEPVFPMELILQE
VSRERWIAIPGPVLDVYRLWRPTPLFRARRLERVLGTPARIYYKYEGVSPAGSHKPNTAV
AQAYYNKQAGVKRLTTETGAGQWGSSLAMACAFFGMELKVYMVRASYLQKPYRRILMETW
GAQCVPSPSPDTASGRRFYEQDPEHPGSLGIAISEAVEDAASRADTKYSLGSVLNHVLLH
QTVIGLEALRQFELAGDYPDVIFGCVGGGSNFAGLTFPFVRDKLQGKDVRIVAVEPAACP
SLTRGVYTYDFGDTARTTPLLKMHTLGHTFIPARIHAGGLRYHGMAPLVSHLYEHGLIEA
IALPQTKVFEGAVLFARAEGIIPAPESAHAVRAAIDEARRCAETGEEKAILIGLSGHGHF
DLAAYEAYLAGKLEDYEYPEEAVRQALAELPKVSG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcagcagagaccgtcaagttcgtgttgaccgaggccgatctcccaacgcactgg
tacaacctggccgccgatctccccacgcttcccccaccgcccatccacccagggaccggg
gaaccggtgggtccggccgacctcgaacccgtctttccgatggaactcatcctccaggaa
gtgagccgcgagcgctggatcgcgatccccgggccggttctcgacgtctaccgactctgg
cgaccgacgccactcttccgagcccgtcggctcgagcgcgtgctcggtacaccagcgcgc
atctactacaagtacgaaggggtcagcccggccgggagtcataagccgaacacggcggtc
gcccaggcctactacaacaagcaggccggcgtgaagcggctcaccaccgagaccggagcg
ggtcagtggggaagctcgctcgccatggcctgcgccttcttcggtatggaactcaaggtg
tatatggtgcgggccagctatctccagaagccgtaccggcgtatcctgatggagacctgg
ggagcccagtgcgtccccagccccagtcccgacaccgcgtccggccggcgcttctacgag
caggatcccgagcatccgggaagcctcggaatcgccatttccgaggcggtcgaggacgca
gcctcgcgcgcggacaccaagtactcgctcgggagcgtgctcaaccacgtgctcctgcac
cagacggtcatcgggctggaggcgctccggcagttcgagctggccggtgactacccggac
gtcatctttggctgtgtcgggggcggttccaacttcgctggtctcacttttcccttcgtg
cgggacaagcttcaggggaaggacgtgcgcatcgtcgccgtcgaaccggccgcctgcccg
tcgctcacccgcggcgtctatacctacgacttcggcgatacggcacggacgacgccgctc
ctcaagatgcatacgctcggccacaccttcatccctgcccggatccacgccggtggcttg
cgctaccatgggatggcaccactggtcagccacctctacgagcacggactgatcgaggcg
atcgcgctcccgcagaccaaggtgttcgagggagccgttctgttcgcccgtgccgagggg
atcattcccgctcccgaatcggcacatgccgtgcgcgctgcgatcgacgaggcccgccgc
tgcgccgagactggcgaagagaaggcgatcctgatcgggctgagcgggcacggccacttc
gatctggcagcctacgaggcctacctcgccgggaagctggaagactacgagtatcccgag
gaagcagtccgccaggcgctcgccgagctgccgaaggtcagcggctga

DBGET integrated database retrieval system