KEGG   Thermomicrobium roseum: trd_A0539Help
Entry
trd_A0539         CDS       T00845                                 

Definition
(GenBank) alcohol dehydrogenase (ADH)
  KO
K18382  NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
tro  Thermomicrobium roseum
Pathway
tro00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:tro00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    trd_A0539
Enzymes [BR:tro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     trd_A0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACM06868
UniProt: B9L425
Position
unnamed:531580..532623
Genome map
AA seq 347 aa AA seqDB search
MLAARLYRYDPAMQEELRLETVPDPTIRQPDEVIVRIVGAGLCRTDLHIIEGVWRPILDP
EGKLLPYTLGHENTGIVEAVGSAVRNVRVGDRVICHPQATCGLCLGCRVGEDMYCTSARF
PGLDSDGGFAQYLVTTERALVKVPEDVDLVDIAPLADAGLTAYRAAKRASRIAPPDGWVV
IIGIGGLGHIALQVLRALAGVRIVAVDRSPLARERAGELGADHVLAGSPDLAAEIRELTG
GGAHVVLDFVGEQGVEQQSWQMLRKGGTHLIIGYGGTLEIPTVRMIFGELTVAGSLVGNY
KELVELIDLVARGKVRVFTQRYTLQEINRAIDDFKHGRYFGRAVITP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgctggctgcgcgactgtatcggtatgatccggcgatgcaggaagagctgcgcctcgag
actgttcccgatccgacgatccggcaaccggacgaggtgatcgtccgtatcgtgggagca
gggctgtgccggaccgatctccacatcatcgagggggtatggcgcccgatcctcgatccg
gaaggaaagctgctcccgtacacgctcggacatgagaacacgggtatcgtcgaggcggtt
ggcagtgccgtgcgcaacgtgcgggtgggagatcgcgtgatttgccacccgcaggccacc
tgcgggctctgtctcggctgccgggtcggggaggacatgtactgcacgagcgcgcggttt
ccgggattggactcggacggtgggttcgcccagtatctcgtcacgaccgaacgggcgctg
gtgaaagtgcctgaggacgtcgatctggtggatatcgcgcccctggccgacgcggggctg
acggcctatcgagcagccaagcgggcgagccgcatcgcgccgccggatggttgggtggtg
atcatcgggatcggcggactcgggcacatcgctctccaggtcctgcgggcactggcgggg
gtgcggatcgtcgccgtcgatcgctcgccattggcgcgggagcgagctggcgagctcggg
gccgaccatgttctggctggtagtcctgatctggccgcggaaattcgggagctcaccggt
ggtggtgcgcacgtcgtgctcgacttcgtcggtgagcagggggtcgaacagcagagctgg
cagatgctccgcaagggcggcacccatctgatcatcggctatggggggacgttggagatt
ccgaccgtacgcatgattttcggcgagttgacggttgctgggagcctggttggaaactac
aaggagctggtcgaactgatcgatcttgtggctcgagggaaagtccgcgtgtttacgcag
cgctacacgctccaagagatcaaccgggcgatcgacgatttcaagcacggacggtatttc
gggcgggcggtgatcacaccgtag

DBGET integrated database retrieval system