KEGG   Thermotoga sp. RQ2: TRQ2_0175Help
Entry
TRQ2_0175         CDS       T00706                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00052  Galactose metabolism
trq00561  Glycerolipid metabolism
trq00600  Sphingolipid metabolism
trq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TRQ2_0175
  Lipid metabolism
   00561 Glycerolipid metabolism
    TRQ2_0175
   00600 Sphingolipid metabolism
    TRQ2_0175
Enzymes [BR:trq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TRQ2_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C LANC_like Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACB08536
UniProt: A0A0F6AJC7
Position
170307..171716
Genome map
AA seq 469 aa AA seqDB search
MKISIIGAGSVRFALQLVGDIAQTEELSKGDTHVYLMDVHEKRLNASYTLAKKYVEELNS
PVKIVKTSSLDEAIDGADFIINTAYPYDPRYHDSGSQRWDEVTDVGERHGYYRGIDSQEL
NMVSTYTYVLSSYPDMKLALEIAEKMKKMAPRAYLMQTANPVFEITQAVRRWTGANIVGF
CHGVAGVYEVFERLGLDPKEVDWQVAGVNHGIWLNRFRYRGEDAYPLLDEWIEKELPKWE
PKNPWDTQMSPAAMDMYRFYGMLPIGDTVRNGTWKYHYNLETKKKWFGKFGGIDNEVERP
KFHEQLRRARERLIKLAEEVHPGMKLTEEHPEIFPKGKLSGEQHIPFINAIANNKRVRLF
LNVENQGTLKDFPDDLVMELPVWVDCCGIHREKVEPDLTHRIKIFYLWPRILRMEWNLEA
YISRDRKVLEEILIRDPRTKSYEQIVQVLDEIFNLPFNEELRRYYKEKL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctccatcatcggagcaggaagcgtgaggttcgcacttcagcttgtgggagat
atcgctcagaccgaagagctctcaaaaggagacacccatgtctacctcatggacgttcac
gaaaaaagactgaatgcatcttacactctcgcgaaaaagtacgtggaagagctgaactct
cctgtgaagatcgtaaaaacatccagtctggatgaagccatagatggagcagacttcatc
ataaacaccgcctatccttacgatccgaggtaccacgacagcggctctcagagatgggac
gaggtcacagatgtcggtgaaagacacggctactacagaggcatcgacagtcaggaactg
aacatggtttccacctacacctacgttctttcttcttatcccgacatgaagctcgccctc
gaaatcgcagagaagatgaagaagatggcacccagagcgtacttgatgcagacggcaaat
cccgtcttcgagatcacacaggcggtgagaaggtggaccggtgcgaacatagtggggttc
tgccacggagttgccggggtctacgaagtcttcgaaagactcggtctcgatccgaaggaa
gtggactggcaggtggcaggtgtgaaccacggtatctggttgaacaggttcagatacaga
ggagaagatgcctatcctctccttgatgagtggatagagaaagagctaccaaagtgggag
ccgaagaatccgtgggacacacagatgtctcctgccgcgatggacatgtacagattctac
ggtatgcttccgataggtgacaccgtgaggaacggtacctggaaataccattacaacctg
gagacgaagaagaagtggtttggaaagttcggtggcatagacaacgaagtggaaaggcca
aaattccacgaacagctcagaagagcaagagagcgcctcataaaactcgcagaagaggtc
catccaggcatgaaactcacagaagaacatcccgagatcttcccgaaagggaaactcagt
ggagaacagcacattcctttcataaacgcgatagcgaacaacaaacgtgtgagactcttc
ctgaacgtagagaaccagggaacgctcaaggactttcccgatgacctcgtgatggaactt
cccgtctgggtggactgctgtggaatccacagagagaaagtggaacccgatctcacccac
cggataaagatcttctatctgtggcccaggattctgagaatggagtggaacttagaagca
tacatctcgagggacagaaaggtgctcgaagagattctcatcagagacccaaggacaaaa
tcctacgagcagatcgtgcaagtgctcgatgagatcttcaacctgccgttcaacgaagag
ttgaggagatactacaaagagaaactctga

DBGET integrated database retrieval system