KEGG   Thermotoga sp. RQ2: TRQ2_0522Help
Entry
TRQ2_0522         CDS       T00706                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00561  Glycerolipid metabolism
trq00640  Propanoate metabolism
trq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    TRQ2_0522
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    TRQ2_0522
Enzymes [BR:trq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     TRQ2_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: ACB08877
UniProt: A0A0F6AK73
Position
525258..526352
Genome map
AA seq 364 aa AA seqDB search
MITTTIFPGRYVQGAGAIDILEEELSRFGGRAFVVIDDFVDKNVLGENFFSSFINVRVNK
QIFGGECSDEEIERLSGLVEEETDVVVGIGGGKTLDTAKAVAYKLKKPVVIVPTIASTDA
PCSALSVIYTPNGEFKRYLFLPKNPDVVLVDTEIVAKAPARFLVAGMGDALATWFEAESC
KQKYAPNMTGRLGSMTAYALARLCYETLLEYGVLAKRSVEEKSVTPALEKIVEANTLLSG
LGFESGGLAAAHAIHNGLTVLENTHKYLHGEKVAIGVLASLFLTDKPRKMIEEVYSFCEE
VGLPTTLAEIGLDGVSDEDLMKVAEKACDKNETIHNEPQPLTSKDVFFALKAADRYGRMR
KNLT
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgataacaaccaccatatttccaggtagatatgttcagggggcaggtgctatcgacatt
ctagaagaagaactttctcgttttggaggaagggcatttgtggtgatcgatgattttgtg
gacaaaaacgtgctaggagaaaatttcttcagctcttttataaacgtcagggtaaacaaa
cagatctttggtggagagtgttcagacgaagagatagagagactttcaggtcttgttgaa
gaagaaacagacgtggtggtgggcataggtggcggaaaaacactcgataccgctaaagcg
gtcgcctataagttgaagaagcctgttgtgattgttccaactattgcctctacagatgct
ccatgcagtgccctttccgtgatttacacaccaaacggggagttcaaaagatacctgttt
ttgccaaagaatccagatgtcgttctagtagacacggagattgtagcgaaagcccccgcg
agatttctcgttgccggaatgggagatgcccttgccacgtggtttgaggcagaatcttgt
aaacagaaatatgctccaaatatgacgggaagacttggttcgatgacagcctacgcactc
gcaagactttgctatgagacacttttagaatacggtgtactcgcgaaaaggtcggtggag
gaaaagtctgtcacacctgcccttgaaaaaatcgttgaggcgaacacccttttaagtggt
ctgggattcgaaagtggaggactggcagctgcacatgctattcacaacggtctcaccgtt
ctggaaaatacccacaagtatttacacggggaaaaagtggccataggagttctcgcatca
ctgtttttgactgacaaacccagaaagatgatcgaagaggtctactctttctgtgaagaa
gtgggattacctactactctggcagagataggacttgatggtgtttcggacgaggatctg
atgaaagtggctgagaaagcctgtgacaagaatgaaacaatacacaacgaaccccaacct
ttgacatcaaaagatgtgtttttcgccctaaaagcagcagacaggtacggaaggatgaga
aaaaacctcacttga

DBGET integrated database retrieval system