KEGG   Thermotoga sp. RQ2: TRQ2_0810Help
Entry
TRQ2_0810         CDS       T00706                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
trq  Thermotoga sp. RQ2
Pathway
trq00260  Glycine, serine and threonine metabolism
trq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
trq01100  Metabolic pathways
trq01110  Biosynthesis of secondary metabolites
trq01130  Biosynthesis of antibiotics
trq01230  Biosynthesis of amino acids
Module
trq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:trq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TRQ2_0810
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TRQ2_0810
Enzymes [BR:trq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TRQ2_0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Cas_APE2256
Motif
Other DBs
NCBI-ProteinID: ACB09162
UniProt: A0A0F6AKX0
Position
834508..835677
Genome map
AA seq 389 aa AA seqDB search
MKGYFGPYGGQYVPEILMPALEELEAAYEGIMKDGSFWREFNDLLRDYAGRPTPLYFARR
LSEKYNARIYLKREDLLHTGAHKINNAIGQVLLAKRMGKTRIIAETGAGQHGVATATAAA
LFGMECVIYMGEEDTIRQKPNVERMKLLGAKVVPVKSGSRTLKDAINEALRDWITNLQTT
YYVIGSVVGPHPYPIIVRNFQKVIGEETKKQILEKEGRLPDYIVACVGGGSNAAGIFYPF
IDSGVKLIGVEAGGEGLETGKHAASLLKGKIGYLHGSKTFVLQDDWGQVQVTHSVSAGLD
YSGVGPEHAYWRETGKVLYDAVTDEEALDAFIELSRLEGIIPALESSHALAYLKKINIKG
KVVVVNLSGRGDKDLESVLNHPYVRERIG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttactttggtccttacggaggtcagtacgttcccgagattctcatgcctgcc
cttgaagaactcgaggcggcttacgagggaatcatgaaggatggatcgttctggagagag
ttcaacgaccttctaagggattacgctggacgccccactcctctttacttcgccagaagg
ttgagtgaaaagtacaacgccaggatttatttgaagcgtgaagatcttcttcacacaggt
gctcacaagataaacaacgccataggtcaggtgcttctcgcgaagaggatgggaaaaaca
agaataatagcggaaacaggagcggggcagcacggcgttgccaccgcgacggccgctgcg
ctctttggaatggagtgcgtcatatacatgggcgaagaagacacgatcagacagaaaccc
aacgttgagagaatgaaactcctcggcgcgaaagtggttcccgtgaagagcggaagcaga
acgctgaaagacgccataaacgaagcccttcgggattggatcacgaaccttcagaccacc
tactacgttatcggatccgtcgtgggacctcacccgtatccgatcatagtgagaaacttt
cagaaggtgattggtgaggaaacaaaaaagcagatccttgagaaggaagggagattgccg
gattacatcgttgcgtgtgttggaggaggaagcaacgctgccggtatcttctacccgttc
atagattccggtgtgaagctgatcggagtggaagccggtggagaaggcctcgaaaccgga
aagcacgcagcttctcttctcaaagggaaaattggatacctacacggaagtaagaccttc
gttcttcaggatgactggggccaggttcaggtgacacactcggtttcggcgggactggac
tattccggtgtggggcctgaacacgcttattggagggagactggaaaagttctgtacgat
gcggtgacggatgaagaagctctcgatgccttcatcgaactttcaaggctggaagggatc
attccagcactcgaaagctctcacgcactggcttacctgaagaagatcaatataaagggt
aaggtcgtcgttgtgaacctttcagggcgcggcgacaaggatttagaatcagttttgaac
catccgtacgtcagggagaggataggatga

DBGET integrated database retrieval system