KEGG   Trichoderma reesei RUT C-30: M419DRAFT_104926Help
Entry
M419DRAFT_104926  CDS       T06031                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
trr  Trichoderma reesei RUT C-30
Pathway
trr00450  Selenocompound metabolism
trr00970  Aminoacyl-tRNA biosynthesis
trr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    M419DRAFT_104926
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    M419DRAFT_104926
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:trr01007]
    M419DRAFT_104926
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:trr03016]
    M419DRAFT_104926
Enzymes [BR:trr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     M419DRAFT_104926
Amino acid related enzymes [BR:trr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   M419DRAFT_104926
Transfer RNA biogenesis [BR:trr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    M419DRAFT_104926
 Prokaryotic type
   Other AARSs
    M419DRAFT_104926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g
Motif
Other DBs
NCBI-ProteinID: ETR97065
JGI: TrireRUTC30_1_104926
UniProt: A0A024RY16
Position
Unknown
AA seq 653 aa AA seqDB search
MAVENPILPVKGKKNVLITSALPYVNNVPHLGNVVGSVLSADVYSRFSKLRDRPTLYICG
TDEYGTATETKALETGQTPQELCDEFHVKHKEIYDWFEIGFDYFGRTSTQKQTEIVQDIF
LKLHERDYLEERTTKQPYCEKHDSFLADRFVEGTCPKCNYDDARGDQCDKCGSLLDPFEL
VNPRCKVDGATPVPRDTTHVFIRLEKLQPEIDKWFQDAHKKYGWPQNGVSITQSWLTKGL
EPRSITRDLKWGVPVPLPGYEKKVIYVWFDACIGYPSITANYTDKWEQWWKNPDEVTLYQ
FMGKDNVPFHTVIFPGSEIGTGYNWTLLNHLSTTEYLNYENGKFSKSRGIGVFGNQAKEI
GLSPSVWRYYLLSNRPETSDTQFEWQAFQLANNSELLANFGNFVNRIVKFVNAKLDGVVP
EFNPSYKDETFDFSAWVKTVNGLLKEYVDLMEKVHIRAGVKAIMEISREGNNLLQGRLDN
ANLAENPERTHTTIGLALNLCHLLASVASPYMPSTSESICKQLNSELAFIPDVWEPTAIK
PGHKIGKAAYLFTRIDDKKIEEWKNKFGGSAETRAAEEAAKKKKQEDKEKKKAKKAAKAA
EAAKNAEAAAKAGAAPEDGKAQDEASAAGGMATSSAEVTKDLPIREKKTVDQN
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgaaaatcccatcctgcccgtcaagggcaagaagaacgtgctcatcaccagc
gccctgccgtacgtgaacaacgtgcctcacctgggcaacgtcgtgggcagcgtgctcagc
gccgacgtctactcgcgcttcagcaagctgcgcgaccggccgacgctctacatctgcggc
acggacgagtacggcacggcgacggagaccaaggcgctggagacgggccagacgccgcag
gagctgtgcgacgagttccacgtcaagcacaaggagatttacgactggttcgagattggc
ttcgactactttggccgcacgtcgacgcagaagcagacggagattgtgcaggacatcttc
ctcaagctgcacgagcgcgactacctcgaggagcggacgacgaagcagccctactgcgag
aagcacgattccttcctggcggaccgcttcgtcgagggcacgtgccccaagtgcaactac
gacgatgcccggggtgaccagtgcgacaagtgcggcagcctgctggatccgtttgagctc
gtcaacccgcggtgcaaggtcgacggcgccacccccgtaccccgggacacgacgcacgtc
ttcatccgcctcgagaagctgcagcccgagattgacaagtggttccaggacgctcacaag
aagtacgggtggcctcagaacggcgtgtccatcacgcagtcgtggttgacaaagggcctg
gagccccgcagcatcaccagagatctgaagtggggtgtgccggtccccttgcccgggtat
gagaagaaggtcatctatgtgtggttcgacgcctgcatcggctatccctccatcacggcc
aactatacggataagtgggagcagtggtggaagaatcccgacgaggtcaccctctatcag
ttcatgggcaaggacaatgtgcccttccacacagtcatcttccccgggtccgagattggc
actggatacaactggaccctgcttaaccacctctccaccaccgagtacttgaactacgag
aacggcaagttttccaagtcaagaggcattggtgtctttggcaaccaggccaaggagatt
ggcctttcgccgtccgtctggcggtactacctcctctcgaaccgaccggaaactagcgac
acccagttcgagtggcaggcgttccagctggccaacaacagcgagctcctggccaacttt
ggcaactttgtcaaccgaatcgtcaagtttgtcaacgccaagctggacggcgttgtcccc
gagttcaacccctcctacaaggatgagacgtttgacttttccgcctgggtcaagacggtc
aatggcctgctgaaggaatacgtcgacctcatggagaaggtccacatccgtgctggtgtc
aaggccatcatggagattagcagggagggcaacaaccttctgcagggccggctggacaat
gccaacctggccgaaaaccccgagcggactcacaccaccattggtctcgctctcaacctc
tgccaccttttggcgtctgtggcctcgccgtacatgccctcgacgagcgagtccatctgc
aagcagctcaacagcgagctggcattcatccccgacgtctgggagcccactgccatcaag
ccgggccacaagattggcaaggccgcctacctgttcaccaggatagacgacaagaagatt
gaggagtggaagaacaagtttggcggctcggccgagacccgcgctgccgaggaggcggcg
aagaagaagaagcaggaggacaaggagaagaagaaggccaagaaggcggccaaggcggcc
gaagccgctaagaatgcagaggctgctgccaaggccggagcggctccagaggatggcaag
gctcaggatgaggcgtctgccgctggaggcatggcgacgtcttctgccgaggtgaccaag
gatttgccgattcgcgagaagaagactgtagaccagaattag

DBGET integrated database retrieval system