KEGG   Trichoderma reesei RUT C-30: M419DRAFT_109912Help
Entry
M419DRAFT_109912  CDS       T06031                                 

Definition
(GenBank) putative threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
trr  Trichoderma reesei RUT C-30
Pathway
trr00260  Glycine, serine and threonine metabolism
trr01100  Metabolic pathways
trr01110  Biosynthesis of secondary metabolites
trr01130  Biosynthesis of antibiotics
trr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:trr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M419DRAFT_109912
Enzymes [BR:trr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     M419DRAFT_109912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ETS02402
JGI: TrireRUTC30_1_109912
UniProt: A0A024SE27
Position
Unknown
AA seq 358 aa AA seqDB search
MPATGAATTKPKYSFTDDYSEGAHPDVLNALLLSNNTQEVGYGRDTYSEAARELIRRHLG
RDDVGVFFVPSGTSANAISIAACLRPHEAVIACSSGHIVTRETGAVEASGHKIINVAPKD
GKMTPETLTKALDDNWHFPHMAKPRLVYISNATEVGTIYTKAELTALKRICEANGLLLFA
DGARIGTALTASINDMTLRDMLELTDIFWIGGTKNGALLGEAVVVKDTKLAEDFEFFVKQ
RGSLLAKGRIMGVQFAELFREEDCLYFKLARQANLAAEKLSRSITGAGYQLSAKTETNQV
FAILPLALVQALQQEFSFYVWEKYGEFAVVRLLTTWATDPAQLERFNKIIFSWQPDVE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccaccggcgccgcaacgacgaagccaaagtacagcttcaccgacgactacagc
gagggcgcccaccccgacgtgctcaatgccctgctgctgagcaacaacacccaggaggtg
ggctacggccgcgacacttacagcgaggcggcccgcgagctgatccgccgccatctcggc
cgcgacgacgtcggcgtcttcttcgtgcccagcggcacctcggccaatgcaatctccatc
gccgcctgtcttcgcccccatgaggccgtcattgcctgcagctccggccacatcgtcacg
cgcgagacgggcgccgtcgaggccagcggccacaagatcatcaacgtcgcccccaaggac
ggcaagatgacgccggaaaccctcaccaaggccctcgacgacaactggcatttccctcac
atggcaaagccccgtctcgtctacatctccaacgccaccgaggtcggcaccatttacaca
aaggccgagctgactgccctgaagcgcatctgcgaagccaacggccttttgctgtttgcc
gacggcgctcgcatcggcactgcgctcacggccagcatcaatgacatgaccctgcgcgat
atgcttgagcttaccgacatcttctggatcggcggcaccaagaacggcgctctcctgggc
gaggccgtagtggtcaaggacaccaagctggccgaggactttgagttcttcgtcaagcag
cgtggctccctcttggccaagggccgcatcatgggcgtgcagtttgcagagctgttccga
gaggaggactgcttgtactttaagcttgcccggcaggccaacttggcggccgagaaactc
tcccggtccatcaccggagccgggtaccagctcagcgccaagacggagacgaaccaggtc
tttgccattcttcctctggccctcgtccaggctctccagcaggagttctcattctatgta
tgggaaaagtacggcgagtttgccgtggtcagactgctgaccacttgggccacggatccg
gcccagctggagaggttcaacaagatcatctttagctggcagccagacgtggagtag

DBGET integrated database retrieval system