KEGG   Trichoderma reesei RUT C-30: M419DRAFT_123959Help
Entry
M419DRAFT_123959  CDS       T06031                                 

Definition
(GenBank) F420H2 dehydrogenase
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
trr  Trichoderma reesei RUT C-30
Pathway
trr00190  Oxidative phosphorylation
trr01100  Metabolic pathways
Module
trr_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:trr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    M419DRAFT_123959
Enzymes [BR:trr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     M419DRAFT_123959
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     M419DRAFT_123959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-ProteinID: ETS00310
JGI: TrireRUTC30_1_123959
UniProt: A0A024S4M2
Position
Unknown
AA seq 286 aa AA seqDB search
MASRLSWRATTGSALEPVRALTRARSGQITRAMSVSAPRMVAVPRDSQNMRTAPREAIGA
LKAPVINPTAKYQSKADNLHRYGTWLMGCLPKYVQQFSVWKDELTIYISPAGVIPVFSFL
KYNTAAEFTQVSSVTACDYPTRSHRFEVVYNLLSVRYNSRIRVKTYADESSPVPSITSLF
SGANWYEREVYDLYGVFFTGHPDLRRIMTDYGFEGHPLRKDFPLTGYTEIRYDEEKKRIV
TEPLELTQAFRNFEGGSSAWEQVGTGEDRKPETFKLPTPKPEEKKQ
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaggctttcgtggagagcgactacgggctcggctcttgagcccgtgagggcc
ttgacgcgagctcgctccggacagatcacccgagcaatgtcggtctcggctcctcggatg
gtcgcagtccctcgggattctcagaacatgcgaacagcccccagagaggccattggggct
ctcaaggcgccggtcatcaatccaacagccaaataccagagcaaggcggacaatcttcat
cgatacggaacctggttgatggggtgcctcccaaaatacgtccagcaattctccgtgtgg
aaagatgaactcaccatctacatctcgcccgccggggttataccggtcttttctttcctc
aagtacaacactgccgccgagttcacccaagtcagcagcgtcaccgcatgcgactaccca
acacgcagtcatcgattcgaggttgtttacaacctgctctctgtgcgatataactctcga
atccgagtcaagacttacgccgacgaatcatcgcctgtgccaagtatcaccagcctgttc
agcggcgccaactggtatgaacgggaggtttacgacttatacggtgtcttcttcactggt
catcccgatctaaggcgcatcatgacggactatggattcgagggtcatcctctgcggaaa
gacttccccctcacgggatatactgagattcgctacgacgaggaaaagaagcggattgtc
accgagcctctggaacttacacaggctttccgaaatttcgagggtggatccagtgcctgg
gaacaagtcggcacgggcgaagatcgcaaacccgaaactttcaaactacctactcccaaa
ccggaagagaagaagcagtag

DBGET integrated database retrieval system