KEGG   Trichoderma reesei RUT C-30: M419DRAFT_13349
Entry
M419DRAFT_13349   CDS       T06031                                 

Definition
(GenBank) nitrite reductase NiiA
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
trr  Trichoderma reesei RUT C-30
Pathway
trr00910  Nitrogen metabolism
trr01100  Metabolic pathways
Module
trr_M00531  Assimilatory nitrate reduction, nitrate => ammonia
trr_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:trr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    M419DRAFT_13349
Enzymes [BR:trr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     M419DRAFT_13349
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox NIR_SIR_ferr Fer2_BFD Rieske_2 Rieske NAD_binding_9 Rubredoxin_C
Other DBs
NCBI-ProteinID: ETR96706
JGI: TrireRUTC30_1_13349
UniProt: A0A024RXL0
Position
Unknown
AA seq 1118 aa
MVGPADNMHQETEDCQPRSRKRVAVVGLGMVGISFIEKLLRYDMESGRDEWEVTVFGEEP
YIAYNRVGLTQYFTNRSIQHLYLSPPEWYSSHSERKLTYHTSDLVIYIDAQAKLLNTANG
RVFHYDECVLATGSDAALPPYMSSEQFRSTRGCFVYRRIKDLDNIIDYATNAPSYIGHRI
RKAAVIGGGLLGLEAAKALLDLEEVDQVVLVERNRWVLSRQLDQEGGTLVLEKVRALGVE
VLLQARVRDLVWNDEKRLTGLLLEGKDGLPDQEFDIDLLVFAVGIKPRDDLSKTTPISVA
RPSGGFIVDNQLRTNLPHIYAIGECASFLGETFGLIAPGIEMADVLAFNLTEGPNHSRRE
MQPPDISTKLKLMGVDVASFGDFFADQGKMSKPLPGLTSSHAARKAQATSLTPEDIKKKV
KALTYRDPFSDVYKKYIFTADGKYILGGMMVGDVKDYVKLVALCNMGKPIEKPPSEFIIG
AARDGEEEGDDLPLDAQVCSCHNVSKGNIVECVKTGGVRSFGEMKSSTKCGMGCGGCVPL
ATSIFNRALQDAGVEISNHICKDFAYSRQDLYQIAKFRKLKDFTTMMRAVGKRPDGLGCE
VCRPAIGSILSSLYNENIMKPSMRQTQDTNDRYLANVQRDGTYSVVPRLPAGEITPKGLK
VIGEVADRFGLYTKITGGQRIDMFGAKKQDLPQIWELLINAGFESGHAYGKALRTVKSCV
GNTWCRYGVGDSVGLAVELENRYKGLRAPHKFKGGVSGCVRECAEAQGKDFGLIATPKGW
NVFVGGNGGAKPRHAELLVEDVTRREAMRILDRFLIFYIQSADKLERTARWIEKYPGGLR
GIKEVIVDDKLGICADLEKEMEALVGSYHCEWTNVVSSQERRKAFRQFANTDETQVVSEQ
VTKRAQKRPVDWPEDISPLHFSLQNIAKDAKWDWQIVCKLSELNRQIDAPTSVTVKYGEV
QLAVWNIPGRGLRASQNMCPHKKAFVLADGLIGEDEHGREYVSCPLHKRNYLLESKGGTG
GGGSCSDTNYSIMTFEAKADEQNDAILIYLPPTEALDAVLSTARWMLRKADGEVKFLVKD
AEPSIEIAEPRVPGKMRSQLSHTAAFQPCGGGGNALEW
NT seq 3357 nt   +upstreamnt  +downstreamnt
atggttgggcccgctgataacatgcaccaagagacagaggactgccagccccgatccagg
aagcgggtcgctgttgttggccttggcatggttggcatttcttttattgagaagcttctc
agatacgacatggaaagcggtcgtgatgagtgggaggtgactgtttttggagaggagccg
tatatcgcatacaaccgtgtcggtcttacacagtactttacgaatcgttccattcagcat
ctgtatctcagcccgccggaatggtactcgtcacactcggagagaaaacttacatatcat
acgtccgatcttgtcatttacatagatgcgcaagccaaactgctcaacacagccaatgga
cgagtcttccactacgacgagtgcgtcctcgccaccggttccgatgctgccttgccacct
tacatgtcctccgagcagtttcgaagcactaggggttgctttgtatacagaaggataaag
gaccttgacaatattatcgattatgccaccaatgccccaagctacattggacatcgcatt
cgcaaggcagctgttatcggtggcgggcttctcggcttggaggcagccaaggctctactg
gatctcgaagaagttgaccaagttgttcttgtggagcgaaatcgatgggtactcagccgc
caacttgatcaagagggcggcacgttggtcctggaaaaggtgagggccctgggcgttgaa
gttctgctacaggcccgagtccgagatcttgtgtggaacgacgagaagcggctcactggg
ttgcttctggagggaaaggatggactgccagaccaggaattcgacatcgaccttctcgtg
tttgctgttggaatcaagccccgagatgatctctccaagactacccctatcagtgtggcc
aggccaagcggaggtttcatcgtcgacaaccagcttcgcacaaacttgcctcatatctac
gctattggagaatgtgccagcttcctcggagaaacatttggtcttatagctcctgggatc
gaaatggccgacgtactcgccttcaatttgacagaaggtcccaaccacagcaggagagag
atgcagcctcccgatatcagcacgaaactcaaattaatgggcgtcgatgtcgcctccttt
ggtgacttctttgcggatcaggggaagatgagcaaaccactgccaggcctgaccagttcc
catgcggccaggaaggctcaggcaacgtctttaacgccggaggatatcaagaagaaggtc
aaggcactcacttaccgggacccattttcggacgtgtacaagaagtacatctttacggca
gatggcaagtacatcttggggggaatgatggttggcgacgtcaaagactacgtgaagctc
gtggccctctgcaatatgggcaaacccattgagaagcccccatctgagtttattatcgga
gcagcaagagatggagaggaggaaggagacgacttacctcttgatgcccaagtatgcagc
tgccataacgtcagtaaaggcaatatcgtggagtgtgtaaagactggtggtgttcgttcc
tttggggagatgaaatcctcaacaaagtgtggcatgggttgcggaggctgcgtgccattg
gctactagcatcttcaaccgcgcacttcaggacgccggcgttgagatctccaaccacatc
tgcaaggattttgcctattcacgccaggatctttaccagattgccaagttcagaaagctc
aaggactttacaacaatgatgcgcgctgtcggcaagaggcctgatggtctcggctgcgaa
gtttgcagaccagccatcgggtcgattctgagttctttgtacaacgaaaacatcatgaag
ccctccatgcgccagacgcaagatacaaacgatcgttatctcgccaatgtgcagcgagac
gggacttattcagttgttccgcgactacctgcaggcgaaatcacaccaaaggggctcaag
gtcattggagaggtcgcagacaggttcggactctacaccaagatcactggcggccagcgt
atcgacatgtttggtgcaaagaagcaggacctcccgcaaatttgggagctgctcatcaat
gctggctttgagagcggccatgcttatggcaaagcgctgcgaacagtcaagtcttgtgtc
ggcaacacttggtgccgttacggcgtaggcgattcagttggtctcgccgttgaactggag
aatcgctacaagggcttgcgtgctccccacaagttcaagggcggtgtatctggttgtgtg
agggaatgtgcagaagcacagggcaaagactttggtctcattgccacccccaaaggttgg
aatgtgtttgtgggcggaaacggcggcgcaaaacctcgccacgctgaactacttgtcgag
gacgtgactagacgtgaagcaatgagaattctcgatcgctttctcatattttacattcag
tcagcagacaaactcgaaagaaccgctcgctggattgagaaataccccggcggcctcagg
ggcatcaaggaggtcatcgttgacgacaagcttggcatatgcgcggacctggaaaaagag
atggaggcactcgttggctcgtatcactgcgagtggaccaacgtggtcagtagtcaggag
cgccgcaaggctttcagacaatttgccaatacggatgagacgcaggtggtatccgagcaa
gtcacaaagcgcgcccagaaacgtcccgtggactggcccgaggatatctcccctctgcac
ttcagcttgcagaatatcgcaaaggatgcaaagtgggattggcagattgtctgcaagctt
tctgagttgaaccgtcagattgacgcaccgacatcggtcactgtcaagtatggcgaagtt
cagctggctgtgtggaatatcccgggccgtggcttgcgcgcttcacagaacatgtgcccg
cacaaaaaggcatttgtgctggcagacggcttgataggtgaagatgagcatggacgggaa
tacgtatcatgtccactgcacaagagaaactacctgctcgagtccaaaggggggacgggg
ggaggtggaagctgctcggatacgaactattccatcatgacattcgaggccaaggcagat
gagcagaatgatgcgatactcatctatcttcctcctacagaagcactggatgctgtcctt
tcgacagccagatggatgctgcgaaaggcagacggagaagtgaagttcttggtcaaggat
gctgagccatcaatcgagatcgcagagcctagggttcctgggaagatgagatctcagttg
tcacataccgctgcctttcaaccctgtggcggcggcggaaatgcgcttgagtggtaa

DBGET integrated database retrieval system