KEGG   Trichoderma reesei RUT C-30: M419DRAFT_141503
Entry
M419DRAFT_141503  CDS       T06031                                 

Definition
(GenBank) ERG4/ERG24 ergosterol biosynthesis protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
trr  Trichoderma reesei RUT C-30
Pathway
trr00100  Steroid biosynthesis
trr01100  Metabolic pathways
trr01110  Biosynthesis of secondary metabolites
Module
trr_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:trr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    M419DRAFT_141503
Enzymes [BR:trr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     M419DRAFT_141503
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-ProteinID: ETS01348
JGI: TrireRUTC30_1_141503
UniProt: A0A024S8D6
Position
Unknown
AA seq 485 aa
MAKPKQAAAEQPHGYEFGGPLGAFGISFGLPVLVYLFTFSCNDISGCPAPSFLSPKTLSL
DQLKLEVGWPKDGIWGLASWEASGALAAYYLLNLILYAILPAQKVEGTVLRSGGRLKYRF
NTLYSNMATLAALAAGTIAQGADFPVWTFISENYVQLLTASILLSYAIATFVYVRSFSVK
AGNKENRELAAGGCTGNMLYDWFIGRELNPRVTIPLIGEVDLKEWCELRPGMMGWIILNC
AWCAQQYRNYGYVTDSAICITVVQALYIIDSWVNEAAILTTMDITTDGFGMMLAFGDLVW
VPFVYSLQTRYLSVYPRSLGPLGLLAMVSLIGTGFYIFRSANSQKNTFRTNPSDPSVAHL
KYIETKTGSKLLTTGWWGIARHINYFGDWIQAWPYCLPTGLAGYQILAAGTPTAEEAFVM
ADGRQVIQGDAKGWGMLITYFYIVYFGILLIHRDGRDDLKCYRKYGEDWNKYKKIVRWRI
IPGIY
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcaaagcccaagcaagctgccgcggagcagcctcacggctacgaattcggaggcccg
ctgggtgcttttggaatctccttcggcctccccgtcctcgtctacctcttcaccttttcc
tgcaacgacatctcgggctgtcccgcgccctcgttcctcagccccaagactctctccctg
gatcagctgaagctcgaggttggctggcccaaagatggcatctggggcctggccagctgg
gaggcatctggtgctttggcggcctactacctcctcaacctgatcctgtacgcgattctc
cccgcgcaaaaggtggagggtacggttctgcgctctggtggccgcctcaagtacaggttc
aacaccctgtactccaacatggccactctcgctgcactggccgctggaacaatcgcccaa
ggcgcagacttccccgtctggaccttcatcagcgaaaactacgtccagctccttaccgcg
agcatcctcctctcatacgccatcgccaccttcgtgtacgtccgaagcttcagtgtcaaa
gccggcaataaggaaaaccgcgagctcgccgccggcggatgcactggcaacatgctatac
gactggttcatcgggcgcgagctgaacccccgcgtcactatccccctcatcggagaggtc
gacttgaaggagtggtgcgagcttcggccgggtatgatgggctggatcattctgaactgc
gcgtggtgcgcccagcagtaccgcaactatggctatgtcacggacagcgccatctgcatc
accgtcgtgcaggcgctgtacatcatcgactcatgggtgaacgaggccgccattttgacg
accatggacatcaccaccgatggattcggcatgatgctggcgttcggagacctcgtttgg
gtcccgttcgtgtactccctccagactcgatacttgtcggtgtatcctcgctcgctcggc
cccctcggacttctcgccatggtgtccctcattggcactggcttctacatcttccgctct
gccaacagccagaagaacactttccgcaccaaccccagtgaccccagcgttgctcatctc
aagtacatcgagaccaagaccggcagcaagctcttgaccacgggctggtggggtatcgcg
cgccacatcaactactttggcgactggatccaggcgtggccgtactgcctgcccacaggc
cttgccgggtaccagatcctcgctgctggcacgcccaccgccgaggaggcctttgtcatg
gccgacggccgacaggtgattcaaggtgacgccaagggctggggcatgctcattacctac
ttctatatcgtgtacttcgggatcctgctcatccaccgcgatggacgagacgatctcaag
tgctatcgcaagtatggcgaggattggaacaagtacaagaagattgtgcgatggaggatc
atccctggcatatactag

DBGET integrated database retrieval system