KEGG   Trichoderma reesei RUT C-30: M419DRAFT_32670Help
Entry
M419DRAFT_32670   CDS       T06031                                 

Definition
(GenBank) pterin 4 alpha carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
trr  Trichoderma reesei RUT C-30
Pathway
trr00790  Folate biosynthesis
trr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M419DRAFT_32670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:trr04147]
    M419DRAFT_32670
Enzymes [BR:trr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     M419DRAFT_32670
Exosome [BR:trr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M419DRAFT_32670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ETS05327
JGI: TrireRUTC30_1_32670
UniProt: A0A024SHU0
Position
Unknown
AA seq 157 aa AA seqDB search
MPRLTVPSLFISKATPFANSAVRQTRFMSSSQAAPKPDSLLVSNGGRWTLTADGEALERS
FKFKTFTKTWDFMTAVSLQCKIHNHHPEWSNVYNTTFIRWTTHVPKGLSEKDINLASICD
SLARDFGELEPEPETSSCEMRGLADEVVKDGSCCVKK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcttaacagtcccgtctctcttcatctccaaagccacaccatttgcaaattcc
gccgtcagacaaacgagattcatgtcttcctcgcaagcagcacccaagccggacagcctc
ctcgtgtccaatggcgggaggtggacgctgacggctgatggagaggcgctggaacggagt
ttcaagtttaagacttttaccaagacttgggactttatgacggccgtttcgctgcagtgc
aaaatccataaccaccacccggaatggtccaacgtctacaacacgacattcattcgctgg
acaacacacgtccccaagggcctgtcagaaaaagacatcaacctagcttccatctgcgat
tccttagccagggactttggtgaactggaaccggagccggaaacgtcgagctgtgagatg
aggggtttggcggatgaggttgtcaaggatgggagttgctgtgtgaagaagtag

DBGET integrated database retrieval system