KEGG   Trichoderma reesei RUT C-30: M419DRAFT_98591Help
Entry
M419DRAFT_98591   CDS       T06031                                 

Definition
(GenBank) putative nuclear import and export protein Msn5
  KO
K14289  exportin-5
Organism
trr  Trichoderma reesei RUT C-30
Pathway
trr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:trr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    M419DRAFT_98591
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:trr03016]
    M419DRAFT_98591
   03036 Chromosome and associated proteins [BR:trr03036]
    M419DRAFT_98591
Transfer RNA biogenesis [BR:trr03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    M419DRAFT_98591
Chromosome and associated proteins [BR:trr03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     M419DRAFT_98591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IBN_N Xpo1 MOR2-PAG1_N IFRD Arm
Motif
Other DBs
NCBI-ProteinID: ETS02646
JGI: TrireRUTC30_1_98591
UniProt: A0A024SDN4
Position
Unknown
AA seq 1277 aa AA seqDB search
MSTNSNGGDARNGGDTDVLAKIHLALEVVHSPHSTNEARREAQSFLEEVKDIPEAPFQGY
NLAADKAQPPVVRHYALSLLEHAIRYRWTTYTEEQARTLRNWVLELSQAVAKDDPGYLRN
KTAQLWVEVAKRSWGSEWTDMDAMLVELWQIPNSPAHKELVMFVLEALSDEVFAGDDPVV
AMREGVLSKACVEIFTPTAVLVEAFPNRQAGPDVRCGHEGWLSRLSDFLGLCISSDAKND
EVKTCIVKGFSVLVSLMPWAIPKAVSSARCVPILSAGLASPSTEIQKAALDALYALYCRS
NFSDEEFRELVAPMYSRASIQLFRDLIDRSAVDADDIDEDKYQILKKLSEMLSILGDYFE
RKHSQVPLDASPEAFLQLLLQVVQHQSLMVSIPVLVTWARLLSNKVIGPSDIVTSMIGPL
LEVCSSRLVRYENLDPENTDPTFLFLMEDTDTIPERHAFLGNYRRFSSQIVELIVQLKLV
DAVSHILGRTEQLLLHLYHGQPPFNKQNYFKHSMPVLQVDAHFTLIEASLKGYAKWKKAH
QHDNPQQIAELESSLEAWCSRLLEMNFEDPLIRKRTLQLLVYFSTNALNKNANFMLKVLE
HIILTWPVLEAEYRAYNEAVKDFQTESMLELHRLAIGMPDHLLGVYDQIEVRVNEMISTG
KLDDRRILAYRSFLFLIIHRAKSIDTQAKVPKLREFVEPVKAQWQEEGIKSAVKSYSGFC
ELLALDKAQAYLVSRQAQNIQDWGSYELDAEGLALQSELEERLKQLPLRATKTLLALSVD
RVDRSTTAFQATCAIWEEGFPNILADLLRLLSYAHASHNPHHWTGFPEDMRHIVDKVLSD
RFWQAGISEGSKDDFYARVFDKKGTMEGLASTIRGTVRFVRETAYGIIYCMSKLHSQFYG
FSELAAPLSEAFFSDSIWLSTHQQSNLLSLVRHLVDDCPVDCRENFLPRLLSSCFQQMDA
KINSEWAKLEQKQSVAADGDAELKEEMKSESILRQVTYTAVVMVADILDPTKPNSPTLKP
QARNVDEQNESGEAYPSLRKFCLAHQEIIEPLLLFCMHGIRMRDIRCCGMVLRLFISLVP
EFSSKRNSTGSDAQGAGGAVDASRISPELASAVREYISSDVMRACVTSFHEPYFVDVQKE
LASLIATIVVYYSPITPTPVNVLLALPNVNPAELERLNAYVPKPASHTRQQRAIVMEFLK
DFKGVSVSEMGKLSKTGVDHSSSGRSKRTGRSKMAQGFMTSAPATSDAAGRKRAEAAGGR
ATPDNDGLEGISNLFEG
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccaactccaacggcggcgacgcgagaaacggcggcgacacagacgtgctcgcc
aagattcacctggcgctcgaggtggttcacagcccgcactcgaccaacgaggcgcgaagg
gaagcccagtccttcctcgaagaagtcaaggacatccccgaagctcccttccagggctac
aacctggccgccgacaaggcccagccgcccgtcgtccgccactacgccctatcgctgctc
gagcatgccatacgataccgatggaccacatataccgaggagcaggcccgcaccctgcga
aactgggtgctggagctgagccaggcggttgccaaggacgatccgggatatctgagaaac
aagactgcccagctgtgggtggaggtggccaagagaagctggggctccgagtggacggac
atggatgccatgcttgtcgagctatggcagattcccaattcccccgcccacaaggagctc
gtcatgtttgtgctcgaggctctgtcggacgaggtctttgctggagacgacccggttgtc
gcaatgagagaaggcgtccttagcaaggcatgcgtcgagatcttcacgcctaccgcggtc
ctggtcgaggccttccccaaccgtcaggccggcccagatgttcgctgtggtcacgagggc
tggctcagtcgactgtcagacttcctgggcctgtgtatcagctccgacgccaagaatgac
gaggttaagacatgcattgtcaagggcttctccgtgctcgtgtcgctcatgccctgggcc
attcctaaagccgtgtcgtctgcccgctgcgtgcctatcctgtctgccggcctagcgtca
ccttcgaccgaaatacaaaaggcagccctagatgccctgtacgccctatattgccggtcc
aacttttcagatgaagagttcagggagcttgtggcccccatgtacagccgtgcatccatt
cagctcttcagggacctcatcgatcgatcagcggtcgatgctgacgacatagatgaagac
aagtaccagatcctgaagaagctatcagagatgctatcgatcctaggtgactacttcgag
aggaagcattcccaggttcccctggacgcaagccccgaggctttcctgcaactcctgctc
caagtagtgcaacaccaaagcctcatggtttcaatcccggtcctggttacgtgggcaagg
ctcctttcgaacaaggtgattggtccgagtgatatcgttacatccatgatcggacctctc
ctcgaggtctgcagctccaggttggtccgatatgagaacctggaccccgagaatactgat
ccgacattcctcttcctgatggaagataccgataccatacccgagcgccacgccttcctg
ggcaattaccgtcgcttcagttcacaaatcgtcgagctcatcgtgcaactcaagcttgta
gatgcagtatcgcatatcctggggcgtactgaacagctcttgctgcacctttaccacggg
cagcctccattcaacaagcaaaactatttcaaacactccatgcctgttctgcaggtggac
gctcacttcacccttatcgaagcatcgttgaagggttacgcaaagtggaaaaaggcgcac
caacacgacaatccgcaacagatagctgagcttgagtccagccttgaagcatggtgctct
aggctcctagagatgaattttgaggatcctcttatccgaaagcgaacactgcagttgctc
gtctacttctcgacaaatgccctcaacaagaatgcaaacttcatgctaaaggtccttgaa
cacattattctcacctggccggttctagaagcagagtatcgcgcgtacaatgaggccgtc
aaggatttccagaccgagagcatgctcgagctgcaccgcctcgcgattggaatgcccgat
cacctcctgggggtctatgaccagatcgaagtccgcgtgaacgagatgatatctaccgga
aagctggatgacaggagaatcctagcatatcggagttttctgtttctcattattcatcga
gccaaaagcatcgacacccaagccaaggtaccaaaacttagggagtttgtcgaacctgtc
aaggctcaatggcaagaggaagggatcaagtctgccgtcaagtcgtattccggcttctgc
gagctccttgcgctggacaaggctcaagcatacttggtcagccgtcaggcacagaacatc
caagactggggatcttatgagcttgacgccgaggggctggctcttcagagcgagttggag
gagcgcttaaagcaactgcctctgcgtgcgacaaagacgctccttgcgctgtccgtggac
cgagtcgacaggtctaccaccgcgttccaggccacctgcgcaatctgggaggaagggttc
ccaaacatcctggcagatttgctgcgtttgttgagctatgcccacgcctcccataacccg
catcactggacgggattcccggaagatatgcgccacattgtagacaaggtcttgagcgat
cgattctggcaggctggcatatcggaaggaagcaaagacgacttttatgcccgtgtgttc
gacaagaagggcacgatggagggtctcgcgtccacaattcgcgggacagttcgctttgtg
cgtgaaacggcttacggcatcatctattgcatgagcaagctccattcacaattctacggg
ttcagcgaactcgccgctccgctgtccgaggccttcttttcggactcgatatggctgtcc
acacaccagcagagcaacttgttgagtctagtgcgtcatctggtggatgactgcccggtg
gactgccgcgagaatttcctgcctagactcttgtcttcgtgcttccagcagatggatgcc
aagatcaactctgagtgggcaaagctcgagcagaagcagagtgtggcggcagatggagat
gccgagctcaaagaggagatgaagtctgagagtattctccggcaagtgacgtacactgcc
gtggtcatggtggcagacattttggaccccacgaagccaaattcgccaacgctcaagcca
caggcccggaatgtcgacgagcagaacgaatctggggaggcttacccctctctgcgaaag
ttttgcttggcccatcaggagatcatcgagccgctcttgcttttttgcatgcacggcatt
cgcatgcgggatatccgatgttgcggaatggtcctgcggctgttcatctccctggtgcca
gagttttcttcgaagagaaactccacgggctccgacgcccagggggctggtggtgccgtc
gacgcatctcgcatctctccagagctcgcctcggccgttcgggagtatatctcttcggac
gtcatgagagcgtgcgtcacgtccttccacgagccgtactttgtagatgtccagaaggag
ttggcatctctcattgccacaatcgtggtgtactacagcccaatcacaccgacgccggtc
aacgttctcctggcactgccaaacgtgaacccagcagaattggagcgtctgaacgcgtac
gtacccaagccagcatcgcacacgcggcaacagagagccattgtcatggagttcttgaag
gacttcaagggagtgagcgtctcggaaatgggtaagctgagcaagaccggcgtggatcat
agcagctcgggacgatctaagcgcactgggcgaagcaagatggcgcagggcttcatgacc
agcgctccagcgacatcggatgctgcgggccgaaagagggcagaggctgcgggaggccgg
gccacccctgataatgatggcctggagggcatctccaacctttttgagggttga

DBGET integrated database retrieval system