KEGG   Terriglobus roseus: Terro_1486Help
Entry
Terro_1486        CDS       T02140                                 

Definition
(GenBank) cystathionine beta-lyase/cystathionine gamma-synthase
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
trs  Terriglobus roseus
Pathway
trs00270  Cysteine and methionine metabolism
trs00450  Selenocompound metabolism
trs01100  Metabolic pathways
trs01110  Biosynthesis of secondary metabolites
trs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:trs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Terro_1486
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Terro_1486
Enzymes [BR:trs01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     Terro_1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2 SelA DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AFL87793
UniProt: I3ZEX5
Position
complement(1756327..1757472)
Genome map
AA seq 381 aa AA seqDB search
MKTATRLVHFDPAPKDPFRPMATPIYQTATFEQEHADSFGEYDYSRSGNPTRRVLEDHMA
ELEGGSRSFAFSSGMTAIATVTRLLKAGDEIVADWDLYGGASRLFDRVVRRAGVTVRLVD
GTDIEAVREAMRPATRMLYVESPTNPLLRVLDLQALASVAQDRGVMFCVDSSAMSPYLQN
PLALGADIVIHSGTKLLCGHSDVMAGIVVVKDEALAKEVYFLQNAEGTALGPMDCFLLLR
GLKTLKLRIDAQQTNAQRIAEHLQQNYPHFEVAYPGLPDHPAHAVQSRQATGAGVLLTFR
AGSPEAAKQIAEGLDLFKIAVSFGSVNSSISIPYAMSHASVPTEQRAQRGIPEDLLRISC
GIEDADDLIADLTTQLERLRS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagccacgcgcctcgtccacttcgaccctgcgcccaaggatcccttccggccg
atggccacgcccatctaccagacggcaaccttcgagcaggaacacgcggacagcttcggc
gagtacgactactcgcgctccggtaatcccacccggcgcgtgctcgaagatcacatggcg
gaactcgaaggcggctctcgcagcttcgccttctccagcggcatgacagccatcgctacc
gtcacgcggctcctcaaggccggcgatgagatcgtcgcggactgggatctctacggcggc
gcaagccgtctcttcgaccgcgtggtgcgccgcgccggcgtcaccgtccgactcgtcgat
ggaaccgacatcgaagccgtacgcgaagccatgcggcccgcaacccgcatgctctacgtc
gagtctccgaccaatccactgctccgcgtcctggaccttcaggcgctcgccagcgttgcg
caggatcgtggcgtcatgttctgcgtcgacagctcagctatgtcgccctacctgcagaac
ccgctcgcactcggcgccgacatcgtcatccactccggcaccaagctgctctgcggccac
agcgacgtcatggcaggcatcgtcgtcgtaaaggacgaggctctcgcgaaagaggtctac
ttcctccaaaacgctgaaggcaccgccctcggccccatggattgcttcctcctgctgcgc
ggcctcaagacgctcaagctccgcatcgacgcgcagcagacaaacgcccagcgcatcgcc
gaacacctgcaacagaactaccctcattttgaggtcgcctaccccggcctgcccgatcac
ccggcccacgccgtgcaatccaggcaggccaccggcgccggcgttctgctcaccttccgc
gcaggatcccccgaagctgcaaagcagatcgcggagggcctcgatctcttcaagatcgcc
gtcagcttcggcagcgtcaactcgtccatcagcatcccgtacgcgatgtcccacgccagc
gttcccacagaacagcgagcccagcgcggcatcccggaagacctgctacggatctcctgc
ggcatcgaagacgccgacgacctcatcgcagacctaaccacacagctcgaacgcctaagg
tcctaa

DBGET integrated database retrieval system