KEGG   Terriglobus roseus: Terro_1654Help
Entry
Terro_1654        CDS       T02140                                 

Definition
(GenBank) siroheme synthase, N-terminal domain protein
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
trs  Terriglobus roseus
Pathway
trs00860  Porphyrin and chlorophyll metabolism
trs01100  Metabolic pathways
trs01110  Biosynthesis of secondary metabolites
trs01120  Microbial metabolism in diverse environments
Module
trs_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:trs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Terro_1654
Enzymes [BR:trs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Terro_1654
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Terro_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Shikimate_DH F420_oxidored TFX_C
Motif
Other DBs
NCBI-ProteinID: AFL87957
UniProt: I3ZFD9
Position
1932127..1932933
Genome map
AA seq 268 aa AA seqDB search
MSLFPIFLKLTGRRCLVVGAGSIAESKIQSLLDADADVTVVATRISAQVQRQAENGEIKL
HLREFVDSDLDGNFLVVAGTDVPEVNRAVFAGCERRNILVNAIDDPPYCDYYFPSIVKRG
DLLIAISTAGESPALAQRLRKELNAQLPLDLGPWLMELGRLRREVIGMEPLGEPRKMLLH
QLAQREVCGAEACPSREMARAHARQHYPQRNPQLMETQELRISNDAPPEGQNVTLVTNAV
PLSEGHGFSHAIHPDEEKAALAAEGTLP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcactctttccaatcttcctgaagctcaccggccgccgctgcctcgtcgtcggtgcg
ggttcgattgcggagtcgaagattcagagcctgctcgatgcggatgcggatgtcaccgtg
gtcgccacacgcatctcggcccaggtgcaacgccaggctgagaacggcgagatcaagctc
cacctgcgcgagtttgtagatagcgatctcgatggcaacttcctcgtcgtcgccggcacc
gatgtgccggaggtgaatcgcgctgtcttcgccggttgcgagcgccgcaatattctcgtc
aacgcgatcgacgatccgccttactgcgactactactttccgtcgatcgtgaagcgtggc
gacctgctgattgccatctcgaccgcaggcgagagcccggcactggcgcagcggttgcgt
aaggaattaaacgcacaactgccgctggacctgggcccgtggctgatggaactggggcga
ctgcgccgcgaagtcatcggcatggaaccgctcggcgagccgcgcaagatgctgctgcat
caactggcgcagcgcgaagtctgcggcgccgaggcatgcccgtcgcgtgagatggctcgc
gcccatgcacggcagcactatccgcagcgcaatccacagttgatggaaacgcaggagtta
cggatatccaacgacgccccgccggaaggccaaaacgtcacccttgtcaccaatgccgtg
ccgctttcggaggggcatggctttagccatgccatccacccggacgaagagaaggcggct
ttagccgctgagggaactctgccatga

DBGET integrated database retrieval system