KEGG   Terriglobus roseus: Terro_2095Help
Entry
Terro_2095        CDS       T02140                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
trs  Terriglobus roseus
Pathway
trs00620  Pyruvate metabolism
trs00630  Glyoxylate and dicarboxylate metabolism
trs01100  Metabolic pathways
trs01110  Biosynthesis of secondary metabolites
trs01120  Microbial metabolism in diverse environments
trs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:trs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Terro_2095
   00630 Glyoxylate and dicarboxylate metabolism
    Terro_2095
Enzymes [BR:trs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Terro_2095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AFL88370
UniProt: I3ZGK2
Position
2481262..2482851
Genome map
AA seq 529 aa AA seqDB search
MQTIEFKTPLTPADEQILTPDAVNFLTALHRNFNARRLELLQARIARQAHLDAGERPDFL
PETASIRSAAWRCAPIPADLQDRRVEITGPVERKMVINALNSGAKVFMADFEDSTTPTWT
NLLEGQANLRDAVRRTITFEAPETGKSYKLNEKTAVLFVRPRGWHLPEQHMIVDGEPMSG
SLFDFGLYLFHNATELLARGSGPYFYLPKMESHLEARLWNDAIVFAQNYIGVPQGSVRAT
VLIETILATFEMDEILYELRDHSAGLNCGRWDYIFSFIKKLAADKTILLPDRGQVTMATH
FMRSYSKLAIKTCHHREISAMGGMSAFIPIKSDPEANERALAQVRADKEREAGDGHDGTW
VAHPGLVPIAMEVFDRLMPGPNQIDKKLDDYTATATDLLQIPTGQITEAGLRQNVAVGLG
YVEAWLRGIGCVPLFNLMEDAATAEISRAQLWQWVHHGAVLADGRAVTADLVDSVIDDEL
SKTRSAVDAKRFAAYERAALMMRDLVRSDRFTDFLTLPAYESVLKEGLA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccattgaattcaagacgccgcttacgcccgctgacgaacagatcctcacaccg
gacgccgtcaacttcctgacggcactccaccgtaacttcaacgcccgccggctcgagctg
ctgcaggcccgcatcgctcgccaggcgcacttggacgcaggcgaacgccctgacttcctg
ccggagaccgccagcattcgcagtgccgcttggcgctgcgcaccgatccctgctgacctc
caggaccgtcgcgtcgagatcaccgggcctgtcgaacgcaagatggtgatcaacgcgctg
aacagcggtgcgaaggtcttcatggcggactttgaagactccaccacacccacctggacc
aacctcctcgaaggtcaggcaaacctgcgggacgccgtccgccgcaccatcaccttcgaa
gccccggagacgggcaaaagctacaagctcaacgagaagacagcagtgctcttcgtacgg
ccgcgcggctggcatctgccggaacagcacatgatcgtggatggcgagccgatgagcggc
tccctcttcgatttcggcctctacctctttcacaacgcgacagagctgcttgcacgcggc
tccggaccgtacttctacctacccaagatggaatcgcatctggaagcgcggctgtggaac
gacgccatcgtcttcgcgcagaactacatcggcgtgccgcaaggctccgtccgcgcaacc
gtgctgatcgagaccatcctcgcgaccttcgaaatggacgagatcctctatgaactgcgc
gaccactcggccggcctcaactgcggtcgctgggactacatcttctcgttcatcaagaag
ctcgccgcagacaagaccatcctcctgccggatcgcggacaggtcaccatggcgacccat
ttcatgcggtcgtactcgaagctcgccatcaagacctgtcaccaccgcgaaatcagcgcc
atgggcggcatgagcgccttcatccccatcaagagcgatcccgaggcaaacgaacgcgct
ctcgcgcaggtccgcgccgacaaggagcgcgaagcaggcgacggacacgacggcacatgg
gtcgcgcatcccggcctcgtacccatcgccatggaggtcttcgaccgcctgatgccggga
ccaaaccagatcgataagaagctcgacgactacaccgcaaccgcgacggacctgctccag
atcccgaccggccagatcaccgaggccggtcttcgtcaaaacgtggcggtcggtctgggc
tacgtcgaagcttggctgcgcggcatcggctgtgtccctctcttcaacctgatggaggat
gccgcgaccgcagagatcagccgcgcccagctctggcaatgggtccaccatggcgctgtg
ctggccgacggccgcgccgtcacggcagatctggtcgacagcgtcattgacgacgaactg
agcaagaccaggtcagccgtagacgcgaagcgctttgcagcctacgaacgcgccgcgctc
atgatgcgcgacctcgttcgcagtgaccgcttcacggacttcctgacgctgcccgcgtac
gaatcggtcctcaaagaaggtctggcgtag

DBGET integrated database retrieval system