KEGG   Terriglobus roseus: Terro_2917Help
Entry
Terro_2917        CDS       T02140                                 

Definition
(GenBank) enolase superfamily enzyme related to L-alanine-DL-glutamate epimerase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
trs  Terriglobus roseus
Pathway
trs00051  Fructose and mannose metabolism
trs01100  Metabolic pathways
trs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:trs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Terro_2917
Enzymes [BR:trs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     Terro_2917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: AFL89152
UniProt: I3ZIT4
Position
complement(3525573..3526904)
Genome map
AA seq 443 aa AA seqDB search
MSTLNPRITAVRTLDLRFPTSRFHIGSDAVNKDPDYSAAYCILETDTGLEGHGLTFTLGR
GTELCVMAVNYLSRFLVGRTLSDITANMAAWVQELTGDTQFRWLGPEKGVIHLAAAALVN
AVWDLWARAEGKPVWRLLADLSPEQIVACIDFRYITDALTPEEALEILRRNEPTKRDRIA
QLLQSGLPAYTTSVGWFGFSDDKIRNLCQQALSEGWTHFKLKVGGDAADDLRRGHIVREE
IGWDHKLMVDANQKWDVGQAIDRTRQLAELDLWWMEEPTSPDDILGHRRIRQETNVRIAT
GEHCQSKVMFKQLLQAEAIDVCQIDSCRVAGVNENLAIILMAAKFGIPVCPHAGGVGLCE
YVQHLSAFDFIWAGASLQDRVVEYVDHLHEHFLTPVQIQRGRYMLPQTAGFSIEIYPESL
REYEFPSGTYWLSPEAQQTATPK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaactctcaatcctcgtatcaccgccgtccgcactctcgatcttcgatttcccacc
tcccggtttcatatcggcagcgacgcggtcaataaagatccggactactccgccgcatac
tgcatcctcgaaaccgacaccggtctcgaaggccacggcctcaccttcacgctcggccgc
ggcaccgaactctgcgtcatggcagtgaactacctgtcgcgcttcctcgtaggccgcacc
ctctcggacatcaccgcgaacatggccgcatgggtgcaggaactcaccggcgacacccag
ttccgctggctcggcccggaaaaaggcgtcatccatctcgccgccgcggcactcgtcaac
gccgtctgggatctctgggcacgcgctgaaggcaagcccgtctggcgcctcctcgcagat
ctgtcgccggaacagatcgtcgcctgcatcgatttccgttacatcaccgacgccctcaca
cccgaagaggcgctcgaaatcctgcgccgcaatgaacccaccaagcgggaccgcatcgcc
caactcctgcagagtggtctgcccgcctacaccacctccgttggctggttcggcttcagc
gacgacaagatccgcaacctctgccagcaggccctctccgaaggctggacacacttcaag
ctcaaggtaggcggcgacgccgcagacgatctccgccgcggccacatcgtccgcgaagag
atcggctgggaccacaaactcatggtcgacgccaatcagaagtgggacgtaggccaggca
atcgaccgcacccgccagctcgcagaactcgacctctggtggatggaagagccgaccagc
cccgacgacatcctgggccaccgccgcatccgtcaggagacaaacgtccgcatcgctaca
ggcgaacactgccagagcaaagtcatgttcaagcagctactccaggccgaagccatcgac
gtctgccagatcgatagctgccgcgtagccggcgtcaacgagaacctcgccatcatcctc
atggccgcaaagttcggcatccccgtctgcccccacgcaggcggcgtcggcctctgcgaa
tacgtccagcacctctccgcctttgacttcatctgggcaggcgcatccctccaggaccga
gtcgtcgaatacgtcgaccacctccacgaacacttcctcacacccgtgcagatccaacgc
ggccgctatatgcttccccaaaccgcaggattcagcatcgaaatctacccggaaagtctc
cgggaatacgagttcccctcgggcacctactggctctcgcccgaagcgcaacaaaccgcc
acaccgaagtaa

DBGET integrated database retrieval system