KEGG   Terriglobus roseus: Terro_2953Help
Entry
Terro_2953        CDS       T02140                                 

Definition
(GenBank) N-acetyl-beta-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
trs  Terriglobus roseus
Pathway
trs00511  Other glycan degradation
trs00520  Amino sugar and nucleotide sugar metabolism
trs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Terro_2953
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Terro_2953
Enzymes [BR:trs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Terro_2953
Chaperones and folding catalysts [BR:trs03110]
 Intramolecular chaperones
  Others
   Terro_2953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b CHB_HEX_C_1 Fn3_assoc Glycohydro_20b2 CBM_6
Motif
Other DBs
NCBI-ProteinID: AFL89188
UniProt: I3ZIX0
Position
3584819..3587113
Genome map
AA seq 764 aa AA seqDB search
MSRTKRALLPVAFCSASIFATSQAQTAISVTPAPAHVETSSGMLDLRRGLAVHTASSDAD
AASVTRYLQGLLATTHTPALLTTSKSKAPQLTFVHRDARKPAQGGNDESYALDVTPAGVT
ITAASRAGYLYGAISLWQMMAHAPGSINAVHIEDGPRFRWRGIMLDSARHMQSEQFILQL
LDYMAEHKLNTFHWHLTEDQGWRIEIKRYPKLTSVGGFRPQTMPPWQAGSNAATGPYGGF
YTQDQIRHIVAYAKERNITVVPEIEMPGHATAALVAYPELGSAKGLPGMPVGWGIYPTLF
NTDDATFEFLQNVLTEVMELFPGEYIHVGGDEALKDQWKANPTVQAKMKELGIHDEDAMQ
SWFMGRMEKFINAHGRRLVGWDEILQGGLSPNATVMSWRGMEGAVSAAKQGHDAILTPNR
PLYFNYRQSDATDETAGRDPVNSLADVYNFKALPATLTAAEQAHVLGVQGSIWSEYVLTE
DRVQHMLFPRAAALAEMAWSPDDRRDYKDFLHRLPADLQRTQDAGMKPALSVFEVQAHAT
PTGTGDHASLQLATQGNLGEIRYTLDGSPVVKTSPVFSGALQVPLPSEVHALAFDGSTAL
GLPIAQKITLASTLRRDSRELDACTGSAGIQMEQDPPRNAERPVFRVVYSNPCWIYRKAD
LDRFSGVTLGMGSIPYIFRSGNRPMPAPSNTITTAKVVVHVDSCKGPVLTTVPLAPAWRK
DGVVPLPSAAVTGTTGVHDLCFAVENTEDPGTVWLLNFIQPTPR
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcaccaaacgcgcactgttgccggtcgcattctgttcggcttcgatttttgct
acttcgcaggcacagactgccatctccgtaacgcctgcgcccgcacatgtggagacgtct
tcaggcatgctggatcttcggcggggtcttgcggttcatacggcatcctctgatgccgac
gcagcttccgtgacacggtatctgcagggcttactcgcaacaacgcacacacctgccctg
cttacgacttcaaaaagcaaggcaccgcagcttaccttcgtgcatcgtgatgcacgcaag
cccgcgcagggtgggaacgacgagagctatgcactggatgtcacgccggccggcgtgaca
attaccgcggcaagccgtgctggttacctctacggcgcgatcagcctctggcagatgatg
gctcatgcgccgggatcgatcaacgccgtgcacattgaagacgggccccgcttccggtgg
cgcggcatcatgctcgattcagcacgtcacatgcaaagtgagcagttcattctgcagttg
ctcgattacatggctgagcacaagctcaataccttccactggcacctgacggaagaccag
ggctggcgcatcgagatcaagcgatacccaaagctcacgtcggtcggcggcttccgtccg
cagaccatgccaccctggcaggccggttcgaacgcagcaaccggcccttacggcggcttc
tacacgcaggatcagatccgccatatcgtggcttacgcgaaggaacgcaacatcacggtc
gtgcccgagatcgagatgccgggccacgccactgctgcactggttgcctatccggaattg
ggcagcgccaagggtctaccgggcatgcccgtgggatgggggatctatcccacactcttc
aacaccgacgatgccaccttcgaatttctgcagaacgtactgaccgaggtgatggaactc
tttcccggagagtacatccacgttggcggcgatgaggcattgaaggaccagtggaaggcc
aacccgaccgttcaggcgaagatgaaagaactcggcatccatgatgaagatgctatgcag
agctggttcatgggtcgcatggagaagttcatcaatgcgcacggtcgaaggctagtgggc
tgggatgagattctgcagggcggcctctcccccaacgccacggtcatgtcctggcgaggt
atggaaggagctgtttccgcagcgaagcagggccatgatgcgatcctgacgccgaaccgt
ccgctgtacttcaattaccgccagagcgatgcaacggacgagaccgctggccgcgaccca
gtaaattcacttgctgacgtctacaactttaaggctcttcccgcaacgctcacagcagcc
gagcaggcgcatgtactcggcgtgcagggttccatctggagcgagtatgtgctgaccgag
gaccgcgttcagcacatgctttttccgcgcgccgcagcactcgccgagatggcatggtcc
ccggacgatcgccgcgactacaaggacttcctgcaccggctgcctgcggatctgcaacgc
acacaagatgccggaatgaagcccgcgctcagtgtcttcgaggtgcaggcacatgccact
ccaacgggtaccggcgaccatgcgagcctgcaactggccacgcagggaaacctgggcgag
atccgctacacgctggatggatcgcctgtggtgaagacctcgcccgtcttcagcggcgcg
ctgcaggttccgctcccctccgaggtgcatgcgctcgcattcgacggcagcacggcgctc
ggcctgcccatcgcgcagaagattacactcgcctcgacccttcggcgcgacagccgcgaa
ctggatgcctgcacaggttccgccggcatccagatggagcaggatccaccgcgtaacgcg
gagcgtcccgtctttcgggtggtctattccaatccgtgctggatctatcgcaaggcagat
cttgatcgctttagcggcgtgacattaggcatggggagcatcccgtatatcttccggtcc
ggcaatcgcccaatgccggcgcccagtaataccatcaccacggcgaaggtcgtagttcac
gtggatagctgcaaaggcccggtgctgacgactgtgccgcttgcaccggcgtggcgtaag
gatggcgtagtgccattgccgtccgcagcagtcaccggtactacaggcgttcacgatctc
tgcttcgcggtggagaatacggaagatccaggcacggtgtggcttctgaatttcatacag
cccacacccagatag

DBGET integrated database retrieval system