KEGG   Terriglobus roseus: Terro_3951Help
Entry
Terro_3951        CDS       T02140                                 

Definition
(GenBank) gamma-glutamyltransferase 1
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
trs  Terriglobus roseus
Pathway
trs00430  Taurine and hypotaurine metabolism
trs00460  Cyanoamino acid metabolism
trs00480  Glutathione metabolism
trs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Terro_3951
   00460 Cyanoamino acid metabolism
    Terro_3951
   00480 Glutathione metabolism
    Terro_3951
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:trs01002]
    Terro_3951
Enzymes [BR:trs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Terro_3951
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Terro_3951
Peptidases and inhibitors [BR:trs01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Terro_3951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AFL90159
UniProt: I3ZLP1
Position
4707858..4709639
Genome map
AA seq 593 aa AA seqDB search
MSGFPRAIAVASLACVAVNGSASAQTLPTPPPVRAPHAMVVSVHHEASDAGLAVLKQGGN
AVDAAVAVAFALAVVYPEAGNIGGGGFMLIKPAHKRGAKKLGDGKAHFIDYREEAPAAAS
RDMYLDKDGNVVKGMSTQGYAASGVPGTVAGMAYAEEHYGKLGLKAAMQPAIKLARDGFV
GTEEELNVWHSALLKKNAEAYRIYQRNGDFYKAGEVIKQPELAATLERIAADPNEFYHGR
MADQIAEEMKSGGGTISKADLEGYSVKDRAPLVGRYHGYEITTAPPPSSGGIVLLETLNI
LTGYDLKKMGGDRSPQQVHLITEAFRRAFMDRSDYLGDPDFTKMPLAQMSNRKYAEAWRR
TIDPVKASVSKDLVRPAGFMPEPPKQKGVTDHTETTHFSVVDADGNAVSNTYTLNFYFGS
GVVVKGLGFAMNDEMDDFTSKVGVPNGFGLIQGPNNAIAPHKRPLSAMTPTVVTKRGKLR
LVLGSPGGPTIISTVTNDLISVLDNGLNVQEAADAPRFHNQYLPDELQVEKRFSAATGDV
LKANGYNVKRSGEFDEHNPGIWGDSELIAVDPKTGELLGGHDTRKGFGKASGY
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcttcccccgcgcgattgctgtcgcgtctcttgcctgcgttgctgtgaacggt
tctgcgtcagcccagactctgcccacgccaccgccagttcgcgctccgcatgccatggtg
gtcagcgtgcatcatgaggcttcggatgcggggctggccgtgctgaagcagggtggcaac
gccgtggatgcggcggtcgccgtggcttttgcgctggccgtggtgtatcccgaggcaggc
aacattggtggcggcggcttcatgctgatcaagccggcgcataagcgcggggcgaagaag
cttggcgacggcaaggcgcactttatcgactatcgcgaagaggcgccggctgctgcatcg
cgcgatatgtatttggacaaggacggcaacgtcgtcaagggcatgagtacgcagggatat
gcagccagcggcgtcccgggcaccgttgcgggcatggcgtatgccgaggagcactacggc
aaactgggcctgaaggcggcgatgcagcctgcgatcaagctggctcgcgatggctttgtg
gggaccgaggaagagctgaatgtgtggcactctgcgctgctaaagaagaacgcggaggcc
tatcgcatctatcagcgcaacggcgatttttacaaggcgggcgaggtgatcaagcagccg
gaactggccgcgacgctggagcgcattgccgccgatccgaacgagttttatcacggacgc
atggcggaccagatcgccgaagagatgaagtccggcggcgggaccatttcgaaggccgac
ctggaaggctactccgtgaaggatcgggccccgctggtcgggcgctatcacggctacgag
atcacgaccgcaccgccaccgtcttccggcggcatcgtcctgctggagacgctgaacatt
ctcacgggttacgacctgaagaagatgggtggcgaccgcagtccgcagcaggtgcacctg
atcaccgaggcttttcgccgtgcgttcatggatcgcagcgactatctgggtgacccggac
tttacgaagatgccgctcgcgcagatgagcaatcggaagtacgccgaggcctggcgcagg
acgattgatccggtgaaggcgagcgtttcgaaggatcttgtgcggcctgccggcttcatg
ccggaaccgccgaagcagaagggcgtgaccgaccacacggagactacgcacttctcggtg
gtggatgcggatggcaacgctgtcagcaacacctacacgctcaacttttacttcggttcg
ggcgtagtggtgaagggtcttggcttcgccatgaatgacgagatggatgacttcaccagc
aaggttggcgtgcccaacggctttggcctcatccaagggccgaacaacgccatcgcaccg
cacaagcggccgctgagcgcgatgacgccgaccgtggtcacgaagcgcggtaagctgcgg
ctggtgctgggatcgccgggcggaccgacgattatctcgaccgtgaccaacgacctgatc
agtgttttggacaacggcctgaacgtgcaggaagcggcggacgcgccacgcttccacaac
cagtacctgccggacgagctgcaggtggagaagcgcttctccgccgcgactggtgacgtg
ctgaaggcgaacggctacaacgtcaaacggtcgggtgagttcgacgaacacaaccccggc
atctggggcgatagcgagctgattgcagtcgatccgaagaccggcgaattgctgggcggg
catgacacgcgtaagggatttgggaaagcaagcggatattga

DBGET integrated database retrieval system