KEGG   Takifugu rubripes (torafugu): 101061228Help
Entry
101061228         CDS       T02386                                 

Definition
(RefSeq) monoacylglycerol lipase abhd6-A-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tru01002]
    101061228
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101061228
Peptidases [BR:tru01002]
 Serine Peptidases
  Family S33
   101061228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 LIDHydrolase DUF2048 Ndr Thioesterase Esterase Abhydrolase_5 Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 101061228
NCBI-ProteinID: XP_003976607
Position
Un
AA seq 352 aa AA seqDB search
MEDSPHWLATSTGQTCAEMELLMLSGGVLLVLVLSLFLAYWFWPGALLKAYNWYWRWRLG
LVVRFSYSGSYRFCYSSRGTPGGATPSILLLHGFSANKDMWLPLVTHLPRNQHVVCVDMP
GHEGTSRTGVEDYSIQGQVFRIHQFVRSVGLDQRPFHLAGASMGGNVAGVYAATYPTQLS
SLTLICPAGLVYPKETKFINHLRNMEQSQQEQQIPLIPSTIQELEDMLALCCYNRPNLPR
QAMKGLLSNRIPNNNFYKEVFKEIVGEKSRHSLQDSLHLITAPAQVIWGKEDQVVHVSGA
TVLQEALPNCQVDVLENCGHSVALERPRKAAQLLAGFLSAQEVGRDDAKKRS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggaggacagtcctcactggctggcaacctccacaggtcagacgtgtgcggagatggag
ctgctgatgctgtctggaggtgttctgctcgtgctggtcctcagcttgttcctggcctac
tggttctggcctggagccctcctgaaggcctacaactggtactggcgctggaggctgggg
ctggtggtccggttctcctacagcggaagttaccgcttctgttattccagccgcggaaca
ccagggggcgccacaccgtcgatcctgctgctgcacggcttctctgccaacaaggacatg
tggctgcctttagtcacgcaccttcccagaaaccagcacgtggtgtgcgtggacatgccg
ggccacgaggggaccagtcgcacaggggtggaggactacagcatccagggtcaggtcttc
aggatccaccagtttgtgcggagcgtcggtctggatcaaagacccttccatctggccggg
gcatcgatgggcgggaacgtcgccggcgtctacgccgccacctaccccacgcagctctcc
agcctcactctgatttgccccgcaggtctggtttaccctaaagaaaccaagttcatcaac
catctcaggaacatggagcagagtcagcaagagcagcagatccctctgatcccctccacg
atccaggagctggaggacatgctggctctctgctgctacaaccggcccaatctgccccgg
caggccatgaagggtctccttagcaacagaatccccaacaacaacttctacaaagaagtg
ttcaaggagatcgtaggagaaaagtctcgccactcgctgcaggacagcttgcatctgatc
acagcaccagcgcaggtgatctgggggaaggaggaccaggtggtgcacgtttccggggca
acggtgctgcaggaagcgctgccgaactgccaggtggacgtgctggagaactgcggccac
tccgtggcgttggagcggcccaggaaggccgcgcaactcctcgcgggcttcctgtctgcg
caggaagtcggccgcgacgacgccaagaagcgttcctga

DBGET integrated database retrieval system