KEGG   Takifugu rubripes (torafugu): 101061448Help
Entry
101061448         CDS       T02386                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04012  ErbB signaling pathway
tru04020  Calcium signaling pathway
tru04114  Oocyte meiosis
tru04217  Necroptosis
tru04261  Adrenergic signaling in cardiomyocytes
tru04310  Wnt signaling pathway
tru04912  GnRH signaling pathway
tru04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101061448
   04310 Wnt signaling pathway
    101061448
   04020 Calcium signaling pathway
    101061448
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101061448
   04217 Necroptosis
    101061448
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101061448
   04916 Melanogenesis
    101061448
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101061448
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tru01001]
    101061448
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101061448
Protein kinases [BR:tru01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101061448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Kdo Pho88 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 101061448
NCBI-ProteinID: XP_003975139
Position
21
AA seq 523 aa AA seqDB search
MATTTRFTDEYQLYEELGKGAFSVVRRCVKLCTGQEYAAKIINTKKLSARDHQKLEREAR
ICRLLKHPNIVRLHDSISEEGFHYLLFDLVTGGELFEDIVAREYYSEADASHCIHQILES
VHHIHQHDIVHRDLKPENLLLASKCKNAAVKLADFGLAIEVQGDQQAWFGXAGTPGYLSP
EVXRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTP
EAKNLINQMLTINPAKRITAQEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLKGA
ILTTMLVSRNFSVGSKQTTSPASVTAAAAAVAAATAKTLLNKKADVKKRKSSSTVQYMEP
QTTVIHNPAERTKESSDSSNTTVEDEDVKARKQEIIKITEQLIEAINNGDFEAYAKICDP
GLTSFEPEALGNLVEGMDFHRFYFENLLAKNNKPIHTTILNPHVHLIGEDAACIAYIRLT
QYVDAQGRPRSSQSEETRVWHRRDSKWQNIHFHCSGAPAAPLQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggccacaacaacgcgattcacagacgaataccaactgtacgaggagctggggaagggc
gccttttccgtggtgcgcagatgtgtgaagctgtgtacaggacaggagtacgccgccaaa
ataatcaacaccaaaaagctgtctgcacgagatcaccagaagctggaacgagaggctcgg
atttgtcgcctgttgaaacatcccaacattgtgcgtctccacgacagtatatcagaggag
ggcttccactacctcctgttcgacttggtgactggaggggagctgtttgaggacatcgta
gcccgagagtactacagcgaggccgatgccagtcactgtatccatcagattctagaaagt
gttcatcacattcaccaacatgacatagtgcacagggacctgaagcctgaaaacttgctc
cttgcaagcaaatgcaagaacgctgcagtgaagctggccgactttggcctcgccattgag
gttcagggggatcagcaggcctggtttggattngctggtacaccaggctatctttcccct
gaggtatngcggaaagaggcatatggtaaacctgtggacatctgggcctgtggggtgatc
ctctacatcctgctggtgggttaccctcctttctgggacgaggaccagcacaaactgtac
cagcagatcaaggctggagcttatgacttcccttcccctgagtgggacaccgtcacccca
gaggctaaaaacctgatcaaccagatgttgaccatcaacccagccaagaggatcacagct
caggaggccctgaagcacccatgggtctgccaacggtccacagtggcgtccatgatgcac
agacaggagactgtggagtgtctgaagaaattcaatgccagaaggaaactcaagggggca
attctgacaactatgttggtttctcgaaacttctctgtgggcagcaagcagaccacctct
ccagcctctgtcaccgcggccgcagcagctgtggctgcggccaccgctaagaccttgctg
aacaaaaaggccgatgtcaagaaacgaaagtccagctcgactgtccagtatatggaacct
cagacaactgtcatccataatccggcggagaggacgaaggaatcgtcagactccagcaac
accaccgtggaggacgaagatgtgaaagcacgcaagcaagagattatcaagatcacagag
cagctgatagaggccatcaataatggggactttgaggcctacgctaagatctgcgatcct
ggactgacttcatttgagccagaagctctggggaacctggtggaggggatggattttcac
agattttactttgaaaaccttttggccaagaacaacaagcccatccacaccaccatctta
aacccccacgtccacttgatcggcgaggacgcggcctgcatcgcttacatccgcctgact
cagtatgttgacgcccagggtcggccgaggtccagccagtctgaggagacccgtgtgtgg
caccgcagagacagcaagtggcagaacatccacttccactgctcaggcgcaccagcggca
ccactgcagtga

DBGET integrated database retrieval system