KEGG   Takifugu rubripes (torafugu): 101061547Help
Entry
101061547         CDS       T02386                                 

Gene name
sos2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04012  ErbB signaling pathway
tru04068  FoxO signaling pathway
tru04150  mTOR signaling pathway
tru04510  Focal adhesion
tru04540  Gap junction
tru04810  Regulation of actin cytoskeleton
tru04910  Insulin signaling pathway
tru04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101061547 (sos2)
   04012 ErbB signaling pathway
    101061547 (sos2)
   04068 FoxO signaling pathway
    101061547 (sos2)
   04150 mTOR signaling pathway
    101061547 (sos2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    101061547 (sos2)
   04540 Gap junction
    101061547 (sos2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101061547 (sos2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101061547 (sos2)
   04912 GnRH signaling pathway
    101061547 (sos2)
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    101061547 (sos2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH Thy1
Motif
Other DBs
NCBI-GeneID: 101061547
NCBI-ProteinID: XP_011613385
Position
2
AA seq 1288 aa AA seqDB search
MQPQQIYDFSSDENSHKWRGLFVQALRKVQKQVHPGLMAKEDALQHIEELILQLLNMLCV
AQPRSVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGYK
VDYHVSLYIVAVLEYISADILKLAGNYVGNIRHYEISQQDIKVSMCADKVLMDMFDQEED
IGLMSQCTEEPSSSGELAYDDLVRLEIAEERQYLRELDLIIKVFRHHFLSNPKIFTPQDV
EVIFSNILDIHELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETMSQDI
LRKDFHEHFNNLMARPTAGLYFQSVAEGFKEAVQYVLPQLMMVPVYHCMHYFELLQQLQE
RSEDQDDRECLKQAITALLNLQCSVDRIYTKHQPRRKPGEPMYRLYSRQVRSKQLAIKRM
NEIQKSIDGWEGKDIGQCCSEFILEGPLIRAGAKHERHNFLFDGLMISCKANQSSRLPGS
GSGAEYRLKEKFVLRKVRIVDREDSVELRHAFELIGKDENCAVFCARTAEEKAAWMAALV
TLQYRSTLDRMLDTVLQHEEQEHPLRLPSPEVYRFAVQDSEENIVFEDKVQSKTGIPIIK
AGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLTLLIERIEIPEPEPTEEDRQA
LWNGDQPMAAELQRFRKEYVQPVQLRVLNVFRQWVEHHFYDFENDPELRSHLEEYITSKI
QLRGKSMRKWVESINKIIKRKLQTQANGVSHNITFESPPPPIEWHICRAGQVDAFDLMTL
HPIEIARQLTLLESELYRAVRPSELVGSVWTKEDKEKNSPNLLRMIRHTTNLTLWFEKCI
VETMNLEERVAVLSRVIEILQVFQELNNFNGVLEVVSAINSVPVYRLDHTFEAIPERKRK
LLEEAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLTRHSKELINFS
KRRKVAEITGEIQQYQNQPYCLKVEHEIRRFFENLNPMGNMGEKEFADYLFKMSLDIEPR
NCRQPPRFPRKTVYTLKSPGIRPVRTSTSGTLKGHPVPLEREPPHKITFRSIAETEPPET
PPSASVPTSPNTPTPPQSASSDLSSVFMEHDLGSLCGSSSSLFGSAHLPTSKLQSVSCGS
LHQLGEEQLKPPPLPPRRKDAMSEAKLSSRSDSPPAIPPRLPPPFPRNQPRPVIYNGPPG
DGPLPSPPPPPPRDPLPDTPPPVPQRPPEIFINYPLNLQPSPVGRYHWEFSSSPSSPNTP
PSTPSPRVPRRSCPLSASQNSLCPLPVP
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccagcagatatacgacttttcaagtgacgagaacagtcacaaatggagaggc
cttttcgtgcaagctttacgaaaggtgcagaagcaggtccacccgggcctcatggcgaag
gaggacgccctgcagcacatcgaggagctgatcctgcagctgctgaacatgctgtgcgtg
gcgcagccgcgctccgtgcaggacgtggaggaacgggtccagaaaaccttcccccaccct
atagataaatgggctattgcagacgcccagtccgccatcgagaaacgcaagaggcgaaac
cctttgcttctccccgtggacaagatacacccactgctgaaggaggttttgggctataaa
gtggactaccacgtctccctgtacatcgtggccgtgctcgagtacatatcggcagacata
ctgaagctggcgggcaactacgtggggaacattcgacactacgaaatcagccagcaggac
atcaaggtgtccatgtgcgccgacaaggtgctgatggacatgtttgaccaggaggaggac
atcggcctgatgtctcagtgcacggaggagccgtcctcctccggggagctggcgtacgac
gacctggtgaggctggagatcgcagaggagcggcagtacctgcgcgagctcgacctcatc
atcaaagtgttccgccaccacttcctctccaaccccaaaatcttcacgccgcaggacgtg
gaggtgatcttcagcaacatcctggacatccacgagctgacggtgaaactgctggggctg
atcgaagacgccgtggagatgacggccgacggcagcccccatccgctggtgggcagctgc
tttgaagacctagcggaggagcaggcctttgacccctacgagaccatgtctcaggatatc
ctccgcaaggatttccacgagcacttcaacaacctgatggcgcggccgaccgccggcctc
tacttccagtcagttgcagaaggcttcaaagaagccgtccagtatgttcttccccagctg
atgatggtcccggtataccattgtatgcactacttcgagctcctgcagcaacttcaggag
cgcagtgaggaccaagatgacagagagtgtctgaaacaggccatcacggcgctgctaaac
ctccagtgcagcgtggaccgcatctatactaaacaccagcctcgccgtaaacccggtgag
cccatgtaccgactgtacagcaggcaggtccgaagcaaacagctggccatcaagcggatg
aacgagatccagaagagcatcgacggctgggaggggaaggacatcggtcagtgctgcagc
gagttcatcctggagggcccgctgatacgggccggcgccaagcacgagaggcacaacttc
ctgtttgatggcctgatgatcagctgcaaggccaatcagagctccaggctcccgggttcg
ggcagcggggcggaataccgcctgaaggagaagtttgtgttgaggaaggtgcgcatcgtg
gatcgcgaggactccgtggagctgcggcacgctttcgaactgattggaaaggacgaaaac
tgcgcggttttctgcgcacggacagcagaggagaaggcggcgtggatggcggcgctggtc
actctgcagtaccgctccacgttggatcgcatgttggatacggtgctgcagcacgaggag
caagagcaccctctgaggctgccctccccggaggtgtaccgctttgccgtgcaggactcg
gaggagaacattgtgtttgaggacaaagtgcagagcaagacggggatccccatcatcaag
gccggcaccgtggtcaagctcatcgagaggctgacctaccacatgtatgctgatcctaac
ttcgtgcgcacgtttctcaccacatatcggtcgttctgcaaacctcaggagctcctcacc
ctgctgatagagaggatcgagatccctgagccggagccgactgaggaggaccgccaggct
ctctggaacggggatcagccgatggctgccgagctgcagaggttcaggaaggagtacgtg
cagccggtccagctcagggttctcaatgtgttccgccagtgggtggagcaccatttctac
gacttcgagaacgacccagagctgagaagtcacctggaggagtacatcaccagcaaaatc
caactgcgaggcaagtctatgaggaagtgggtggagtccatcaacaagatcatcaagagg
aagctgcagacgcaggccaacggcgtcagtcacaacatcaccttcgagagcccgcctccc
cccatcgagtggcatatatgcagggcggggcaggtggacgcctttgacctcatgaccctc
catcccatagagatcgctcgccagctgactctgctcgaatcggagctctacagagccgtg
aggccgtccgagctggtcggcagtgtctggaccaaagaggacaaagagaagaactcgcct
aacttgctccgcatgatccgccacaccaccaacctcacgctgtggtttgagaagtgtatc
gtggagaccatgaatctagaggagcgggtggccgtgctgtcgcgggtcatcgagatcctg
caggtgttccaggagctcaacaacttcaacggcgtgctggaggtggtcagcgccatcaac
tctgtcccagtgtacaggctggaccacacctttgaggcaatcccagaaaggaaaaggaaa
ctcctggaagaagctgtggagctgagccaggaccacttcaagaagtacctggctaaactc
aagtccatcaacccgccctgcgtccctttctttggtatctacctgaccaacatcctgaaa
acagaggagggcaacccagacttcctcacgcgccacagcaaggagctgatcaacttcagc
aagaggaggaaagtggctgaaatcaccggggagatccagcagtatcagaaccagccgtat
tgtctgaaggtggagcatgaaatcaggaggttcttcgagaacctgaacccgatgggcaac
atgggggagaaggagtttgccgactacttgttcaaaatgtctctggacatcgagccacgg
aactgcaggcagcctcccagatttcccaggaagaccgtgtacacgctgaagtccccgggg
atccgacccgtgcggacctctacctctggcacgctgaagggccacccggtccccctggag
cgggagcccccgcacaagatcaccttcaggagcatcgcggagaccgaaccgccggagacg
ccgccgtccgcctcggtgcccacctccccgaacacgccgacgcccccgcagtcggcctcg
tccgacctgagctcggtgttcatggagcacgacctgggcagcttgtgcggcagtagcagc
tccttattcggttcggctcatcttccgacttccaagctccagtctgtgtcctgcggcagc
ctgcaccaactcggggaggagcagctgaagccccctccgctaccccccaggaggaaagat
gccatgtctgaggctaaactgagctccaggtccgacagcccccccgccatcccgccccgg
ctgcctcctccttttcccaggaaccagccccgaccggtgatctacaacggcccccccggc
gacggccccctgcccagccctcctccgccgcctccacgggaccctctgcccgacacgcct
cccccggtgccccagcggcccccggagatcttcatcaactaccccctgaacctgcagccc
tccccggtgggccgctaccactgggaattcagcagctccccgagctccccgaacactcca
cccagcacgccctcgccacgcgtcccccgccggagctgcccgctcagcgccagccagaac
agcctctgtccgctccccgttcca

DBGET integrated database retrieval system