KEGG   Takifugu rubripes (torafugu): 101061653Help
Entry
101061653         CDS       T02386                                 

Definition
(RefSeq) HRAS-like suppressor 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00564  Glycerophospholipid metabolism
tru00565  Ether lipid metabolism
tru00590  Arachidonic acid metabolism
tru00591  Linoleic acid metabolism
tru00592  alpha-Linolenic acid metabolism
tru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101061653
   00565 Ether lipid metabolism
    101061653
   00590 Arachidonic acid metabolism
    101061653
   00591 Linoleic acid metabolism
    101061653
   00592 alpha-Linolenic acid metabolism
    101061653
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101061653
    3.1.1.32  phospholipase A1
     101061653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT Calici_PP_N NLPC_P60 TraD
Motif
Other DBs
NCBI-GeneID: 101061653
NCBI-ProteinID: XP_011608826
UniProt: H2UHT7
Position
14
AA seq 170 aa AA seqDB search
MAPVLYDEKPELGDLIEIHRGSYQHWAVYVGDGFVVHLAPPFEGRGGQSSSVMSLVADRA
VVKREELWDVVGTDKWTINNGLDNKYQPRPSHIIVKAACELVGQPLPYCLFRGNCEHFVN
ELRYGKAESRQVRTAGEMVLAAGVVAAVGFGIVALAGALFGGSKKENNTK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggctccagtcctgtatgatgagaaaccagaactgggagacttgatagaaatacaccgc
ggttcctatcagcactgggccgtctatgttggtgatggatttgtggttcatttggcacca
ccatttgaaggacggggtggacagtccagcagcgtcatgtcactcgttgctgatcgggct
gtcgtgaagagagaggagctgtgggatgtggtgggaaccgacaagtggacaatcaacaac
ggcttggacaacaagtatcagccccgtccaagtcacatcatcgtgaaggcagcctgcgag
ctggtgggccagccgctgccgtactgcctcttcagaggcaactgcgaacactttgttaac
gaactccgctatggaaaagcagaatctcggcaggtgcgcacggctggtgaaatggtcctg
gctgcaggggtggttgctgcggtggggtttgggatcgtggctctggcaggagctcttttt
ggaggcagcaagaaagaaaacaacacaaagtga

DBGET integrated database retrieval system