KEGG   Takifugu rubripes (torafugu): 101061957Help
Entry
101061957         CDS       T02386                                 

Gene name
tgfbr2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04060  Cytokine-cytokine receptor interaction
tru04068  FoxO signaling pathway
tru04144  Endocytosis
tru04218  Cellular senescence
tru04350  TGF-beta signaling pathway
tru04520  Adherens junction
tru04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101061957 (tgfbr2)
   04350 TGF-beta signaling pathway
    101061957 (tgfbr2)
   04068 FoxO signaling pathway
    101061957 (tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101061957 (tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101061957 (tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    101061957 (tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101061957 (tgfbr2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101061957 (tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tru01001]
    101061957 (tgfbr2)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101061957 (tgfbr2)
Protein kinases [BR:tru01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101061957 (tgfbr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 101061957
NCBI-ProteinID: XP_003969323
UniProt: H2T2A3
Position
12
AA seq 542 aa AA seqDB search
MELLGVAVFWCGTILCGSVLLREAESYIMKMPRLCKFCDVRATSCAGVRSCKVECDITSI
CPDKQDVCVSIWRKTDANVTFDTVCHNPAQALHGVLLDDYNNSKCQMKEIKGRGSQFFIC
SCSVDECNEHTFFNPTTDSPVVAVVLVSLVPLLVMAVVVIASFYWYRVYRQRKASSRRKK
GPPLDFSDNRAIMMDDEGSDSSSTHANNLNHNTELLPIELDVQVGKGRFAEVYRAKLKQG
SSVSGEQGFETVAIKIFPYEEYASWKTEKEIFSDADLRHDNVLHFLTAEERKVQRQYWLI
TAYHPAGNLQEYLIHHVINWHDLWTLGGSLACGVAHLHSDRTACRRYKVPVAHRDIKSSN
ILVKNDLTCCLCDFGLALRLENNLSVDELANSGQVGTARYMAPEVLESRINLENIESFKQ
ADVYSMALVLWELTSRCNAIGEVKEYEPPFGNLRENPCVESMKDSVLRDRGRPEVPNSWS
NHPGIQIVCTSIDECWDHDPEARLTAQCVAERFYDLEYLDKLSDRSDSEEKIPEQISVVD
EK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggagctactcggcgtggccgttttttggtgcgggacgatcctctgcggctccgtcctg
ctgcgggaggcggaatcctacatcatgaagatgccgaggctgtgcaagttctgcgacgtg
cgcgccaccagctgcgcgggcgtcaggagctgcaaggtggagtgtgacatcacctccatc
tgcccggacaagcaggacgtgtgcgtcagtatctggaggaagacggacgccaacgtgacc
tttgacaccgtttgccacaaccctgctcaagcgctgcacggagtgctgctggatgactac
aacaacagcaagtgccaaatgaaagaaatcaagggaaggggctcgcagttcttcatctgc
tcctgctcagtggacgagtgcaacgaacacacgttcttcaaccccaccacggactctccg
gtggtggcggtcgtcttagtgagcctggtgcctctcttggtcatggccgttgtcgtcatc
gcctccttctactggtaccgagtctaccgccagaggaaagccagctcccggcgtaagaaa
ggtcctcccctggacttcagcgataaccgagccatcatgatggacgacgaaggttccgac
agtagctccacgcacgctaacaaccttaaccacaacacggagttgctgcccatcgagctg
gacgttcaggtcgggaaaggacgctttgcagaggtttacagagccaagctcaagcagggc
tcttcggtcagcggggagcagggcttcgagacggtggccatcaagatcttcccgtacgag
gagtatgcctcctggaagaccgagaaggaaatcttctccgacgcagatctgagacacgac
aacgtgctccacttcctgacggcggaggaacggaaggtgcaaagacagtactggctgatc
acggcctaccacccagcagggaacctgcaggagtacctgattcaccatgtgatcaactgg
catgacctgtggacgctggggggctccttggcctgcggggtggcgcacctccacagcgac
cgcaccgcctgccggcgctacaaagtgcccgtggcacacagggacatcaagagctccaac
atcctggtgaagaacgacctgacctgctgcctgtgtgatttcgggctggcgctgcgcctg
gagaacaacctgtcggtggacgagctggccaacagtggacaggtgggaacagccaggtac
atggccccagaagtgttggagtccagaatcaatctggaaaacattgagtccttcaaacag
gccgacgtgtactccatggcgctcgtactgtgggagctcacctccaggtgtaacgcaatt
ggagaggtcaaagaatatgaaccaccatttgggaatctgagggaaaatccatgtgtggag
agcatgaaggacagtgttctgagagacagaggaaggcctgaggtccccaacagctggagc
aaccacccgggcatccagatagtgtgcacctccatagacgagtgttgggaccacgacccg
gaggcccgtctgacagcgcagtgtgtcgccgaacgcttctatgacctggagtacctggac
aagctgtcggaccgttctgattcggaggagaagatccccgaacagatctctgtggtcgat
gagaagtag

DBGET integrated database retrieval system